StarFunc result for job id Q5T890

User Input

>input (1561 residues)
MQPGSAPPPGRMDPSAPQPRAETSGKDIWHPGERCLAPSPDNGKLCEASIKSITVDENGK
SFAVVLYADFQERKIPLKQLQEVKFVKDCPRNLIFDDEDLEKPYFPNRKFPSSSVAFKLS
DNGDSIPYTINRYLRDYQREGTRFLYGHYIHGGGCILGDDMGLGKTVQVISFLAAVLHKK
GTREDIENNMPEFLLRSMKKEPLSSTAKKMFLIVAPLSVLYNWKDELDTWGYFRVTVLHG
NRKDNELIRVKQRKCEIALTTYETLRLCLDELNSLEWSAVIVDEAHRIKNPKARVTEVMK
ALKCNVRIGLTGTILQNNMKELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRE
LATGRKAMQRLAKKMSGWFLRRTKTLIKDQLPKKEDRMVYCSLTDFQKAVYQTVLETEDV
TLILQSSEPCTCRSGQKRRNCCYKTNSHGETVKTLYLSYLTVLQKVANHVALLQAASTSK
QQETLIKRICDQVFSRFPDFVQKSKDAAFETLSDPKYSGKMKVLQQLLNHCRKNRDKVLL
FSFSTKLLDVLQQYCMASGLDYRRLDGSTKSEERLKIVKEFNSTQDVNICLVSTMAGGLG
LNFVGANVVVLFDPTWNPANDLQAIDRAYRIGQCRDVKVLRLISLGTVEEIMYLRQIYKQ
QLHCVVVGSENAKRYFEAVQGSKEHQGELFGIHNLFKFRSQGSCLTKDILEREGQVEAGI
MTATTWLKEGPPAHKLEMPRQPDCQECRGTEQAAEPLAKEACDLCSDFSDEEPVGATGIK
TAKNKAPDSSKASSSPGQLTLLQCGFSKLLETKCKAVEDSDGNTASDDESSDEQPTCLST
EAKDAGCEKNQDSLGTSKHQKLDNILNPKEKHIFYKSEKILEQNISSKSDEKKIKNTDKH
CILQNVTESEDSDVICPTQYTTERFPDNSIRFKPPLEGSEDSETEHTVKTRNNDNSRNTD
DKRNGIISKKLSPENTTLKSILKRKGTSDISDESDDIEISSKSRVRKRASSLRFKRIKET
KKELHNSPKTMNKTNQVYAANEDHNSQFIDDYSSSDESLSVSHFSFSKQSHRPRTIRDRT
SFSSKLPSHNKKNSTFIPRKPMKCSNEKVVNQEQSYESMDKFLDGVQEVAYIHSNQNVIG
SSKAENHMSRWAAHDVFELKQFSQLPANIAVCSSKTYKEKVDADTLPHTKKGQQPSEGSI
SLPLYISNPVNQKKKKVYHTNQTTFIIGETPKGIRRKQFEEMASYFNSSSVNEFAKHITN
ATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLS
DSETLSFKDSTNKISQVCSLKTYKRKSVKFQNHISYREEVFFNDAETKKSPVSSTQEIDS
GKNSQASEDTVTSRSLNSESETRERRLENTMKDQQDLTRTGISRKEPLLKLENKKIENPV
LENTSVISLLGDTSILDDLFKSHGNSPTQLPKKVLSGPMEKAKQRPKDFWDILNEQNDES
LSKLTDLAVIETLCEKAPLAAPFKRREEPATSLWKSNEKFLWKKFSPSDTDENATNTQST
T

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T890	1.000	1.000	0.000	1561	1.000	1.000	Q5T890.pdb.gz	ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=2
2	AFDB:Q2NKX8	0.317	0.393	3.150E-46	1250	0.170	0.212	Q2NKX8.pdb.gz	ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1
3	PDB:7oo3b	0.305	0.852	2.209E-43	534	0.122	0.358	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
4	PDB:6g0lM	0.255	0.451	1.397E-30	855	0.105	0.192	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
5	PDB:6jylK	0.256	0.764	2.137E-30	504	0.099	0.306	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
6	PDB:5vvrM	0.257	0.739	4.262E-30	503	0.115	0.356	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
7	PDB:6tdaS	0.251	0.490	1.886E-29	783	0.096	0.192	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:7epuB	0.181	0.328	3.892E-28	748	0.104	0.217	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
9	PDB:6g0lW	0.261	0.453	9.600E-28	878	0.107	0.190	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
10	PDB:6uxwA	0.265	0.516	3.088E-27	778	0.096	0.193	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
11	PDB:6gejM	0.234	0.510	1.165E-26	688	0.102	0.231	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
12	PDB:6kw3Y	0.258	0.696	1.064E-24	548	0.102	0.290	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
13	AFDB:Q61687	0.303	0.194	2.848E-21	2476	0.115	0.072	Q61687.pdb.gz	ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus OX=10090 GN=Atrx PE=1 SV=3
14	AFDB:P46100	0.301	0.191	1.700E-19	2492	0.108	0.068	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
15	AFDB:Q8T145	0.236	0.208	3.216E-19	1789	0.143	0.125	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
16	AFDB:Q8IYD8	0.228	0.179	3.367E-13	2048	0.133	0.101	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
17	AFDB:Q6DFV5	0.154	0.128	2.386E-6	1964	0.111	0.088	Q6DFV5.pdb.gz	HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus OX=10090 GN=Helz PE=1 SV=2
18	AFDB:Q8CGS6	0.155	0.101	6.205E-6	2544	0.144	0.088	Q8CGS6.pdb.gz	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
19	AFDB:F4IDQ6	0.165	0.163	1.001E-5	1576	0.115	0.114	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
20	AFDB:O00268	0.030	0.038	6.645E-4	1085	0.061	0.088	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UJ07	0.0	3224	1550	0.993	1.000	A0A590UJ07_HUMAN ERCC excision repair 6 like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=1
2	H0Y3T7	0.0	2184	1058	0.671	0.990	H0Y3T7_HUMAN ERCC excision repair 6 like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=2
3	Q5T890	0.0	3247	1561	1.000	1.000	ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=2
4	Q9ZV43	5.09e-88	316	1187	0.120	0.158	CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana OX=3702 GN=CHR8 PE=2 SV=1
5	Q03468	4.60e-85	310	1493	0.124	0.129	ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
6	A0A0G2JTU1	3.41e-83	304	1474	0.122	0.129	A0A0G2JTU1_RAT ERCC excision repair 6, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Ercc6 PE=1 SV=1
7	F8VPZ5	1.74e-82	301	1481	0.120	0.127	ERCC6_MOUSE DNA excision repair protein ERCC-6 OS=Mus musculus OX=10090 GN=Ercc6 PE=1 SV=1
8	P40352	2.59e-78	285	1085	0.124	0.178	RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1
9	Q9UR24	4.97e-78	282	973	0.117	0.188	RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp26 PE=4 SV=1
10	G5EEN6	2.60e-76	274	818	0.117	0.224	G5EEN6_CAEEL DNA repair and recombination protein RAD54-like OS=Caenorhabditis elegans OX=6239 GN=rad-54.l PE=1 SV=1
11	P41410	2.47e-75	271	852	0.115	0.210	RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp54 PE=1 SV=2
12	Q8W103	4.29e-74	272	1090	0.119	0.170	CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana OX=3702 GN=CHR24 PE=2 SV=1
13	Q57UN8	1.98e-73	270	1126	0.119	0.165	Q57UN8_TRYB2 DNA excision repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.540 PE=4 SV=1
14	Q0PCS3	1.14e-72	265	910	0.121	0.208	CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana OX=3702 GN=CHR25 PE=1 SV=1
15	Q9Y620	1.33e-72	265	910	0.124	0.212	RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens OX=9606 GN=RAD54B PE=1 SV=1
16	Q6PFE3	4.34e-72	263	886	0.122	0.214	RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus OX=10090 GN=Rad54b PE=2 SV=1
17	F1LYB7	9.00e-72	261	888	0.123	0.216	F1LYB7_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=2
18	A0A8I6AM82	1.35e-71	261	911	0.123	0.211	A0A8I6AM82_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=1
19	A0A0P0WGX7	2.80e-71	262	987	0.121	0.191	ENL1_ORYSJ SNF2 domain-containing protein ENL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENL1 PE=2 SV=1
20	A0A0A0MRP6	5.85e-70	259	1058	0.111	0.164	A0A0A0MRP6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16203 ERCC3_RAD25_C	0.051	24.4	ERCC3/RAD25/XPB C-terminal helicase
2	PF00271 Helicase_C	2.2e-17	74.7	Helicase conserved C-terminal domain
3	PF13307 Helicase_C_2	4.8e+02	12.3	Helicase C-terminal domain
4	PF00176 SNF2-rel_dom	2.4e-52	189.4	SNF2-related domain
5	PF14773 VIGSSK	0.032	25.6	Helicase-associated putative binding domain, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003811210.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003816187.1	0.935	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
2	9597.XP_008960695.1	0.934	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
3	9597.XP_008952746.1	0.906	DNA-directed RNA polymerase II subunit RPB2
4	9597.XP_003828299.1	0.896	RNA polymerase II subunit D
5	9597.XP_008958403.1	0.868	Belongs to the histone H2B family.
6	9597.XP_003827456.1	0.860	ERCC excision repair 8, CSA ubiquitin ligase complex subunit
7	9597.XP_003828553.1	0.854	RNA polymerase II subunit G
8	9597.XP_003806466.1	0.853	UBX domain-containing protein 7
9	9597.XP_008955691.1	0.844	ERCC excision repair 5, endonuclease
10	9597.XP_003832737.1	0.832	ERCC excision repair 4, endonuclease catalytic subunit
11	9597.XP_003823789.1	0.829	RNA polymerase II subunit C
12	9597.XP_003831801.1	0.829	Fanconi anemia group M protein isoform X1
13	9597.XP_008973314.1	0.826	DNA-directed RNA polymerases I, II, and III subunit RPABC2 isoform X1
14	9597.XP_008964610.1	0.825	RNA polymerase II subunit E
15	9597.XP_003821755.1	0.818	RNA polymerase II subunit K
16	9597.XP_008953670.1	0.818	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non- coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.
17	9597.XP_008972303.1	0.815	XPA, DNA damage recognition and repair factor
18	9597.XP_003817575.1	0.781	ERCC excision repair 2, TFIIH core complex helicase subunit
19	9597.XP_003828312.1	0.781	ERCC excision repair 3, TFIIH core complex helicase subunit
20	9597.XP_008963004.1	0.773	Bromodomain PHD finger transcription factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:0003824	0.927	catalytic activity
GO:0097159	0.634	organic cyclic compound binding
GO:1901363	0.613	heterocyclic compound binding
GO:0003676	0.498	nucleic acid binding
GO:0140657	0.469	ATP-dependent activity
GO:0003677	0.449	DNA binding
GO:0008094	0.413	ATP-dependent activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0043170	0.960	macromolecule metabolic process
GO:0050896	0.948	response to stimulus
GO:0090304	0.914	nucleic acid metabolic process
GO:0006281	0.893	DNA repair
GO:0042221	0.884	response to chemical
GO:0065007	0.823	biological regulation
GO:0070887	0.745	cellular response to chemical stimulus
GO:0036297	0.728	interstrand cross-link repair
GO:0006979	0.611	response to oxidative stress
GO:0034599	0.553	cellular response to oxidative stress
GO:0050789	0.483	regulation of biological process
GO:0050794	0.412	regulation of cellular process
GO:0019222	0.379	regulation of metabolic process
GO:0060255	0.361	regulation of macromolecule metabolic process
GO:0080090	0.350	regulation of primary metabolic process
GO:0031323	0.349	regulation of cellular metabolic process
GO:0051171	0.342	regulation of nitrogen compound metabolic process
GO:0016043	0.327	cellular component organization
GO:0034614	0.313	cellular response to reactive oxygen species
GO:0019219	0.304	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.992	cytoplasm
GO:0032991	0.987	protein-containing complex
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005829	0.965	cytosol
GO:0005739	0.341	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]