StarFunc result for job id Q5T8A7

User Input

>input (1209 residues)
MFLMNASPVVALQSKWEAFGPPGSCRFPRCFSEADEGVESASVSARVQMLISTLQRDGAA
RGTSDERAAQRGHRAEGCHDARPAAKPTVHKEPPALAVCGLVADFDPMGEEETTDFGPLV
LDSDSDDSVDRDIEEAIQEYLKAKSGAAQPGAGGAQPGAAQPSRAAGGGSRCKPEPAHGS
APTALCPPKLVPGSGGGPGSQVGSSKDQGSASPVSVSSDDSFEQSIRAEIEQFLNEKRQH
ETQKCDGSVEKKPDTNENSAKSLLKSHQEPPTKVVHRQGLLGVQKEFAFRKPPRLAKMNV
QPRSLRSKVTTTQENEGSTKPATPCRPSEAAQNKGGIKRSASAARRGKRVMSAAQASEAS
DSSSDDGIEEAIQLYQLQKTRKEADGDLPQRVQLREERAPDPPAHSTSSATKSALPETHR
KTPSKKKLVATKTMDPGPGGLDTDHAPKLLKETKAPPPASPASRSEFVERSSCRADTSAE
LMCAEAILDISKTILPAPVEGSDGSLSASPLFYSPNVPSRSDGDSSSVDSDDSIEQEIRT
FLALKAQSGSLLARGESCPQAAQGPLLPPGLNSQTGGHKTPLSKTPDPLLGCKRKRRGGG
HVRPSTPKKMQEVVKDGSQDADHSQGRAEPGHERRDLPIQGKASEALGGEGTARGPGDTR
MSQGQGKTDEARRLDEKESSEDKSSSLDSDEDLDTAIKDLLRSKRKLKKRCREPRAACRK
KVRFSTAQTHFLEQLGGLRRDWKDRGPPVLKSCLSKSKRDSGEGPGKKPPSVFGSTAERM
RQEGAASQDAALAFRVRRPASASASEGNPFPRESQGPAPSPGSLSDDSSSVDSNDSIELE
IRKFLAEKAKESVSSSEVQAEGPTALGTGGPARPEVLCRKEPAPPPGVCTRSQRARGVPH
LAEGLRGTESAGAQGTAGLFSQGGKGLPAAPARGDPVPPRSTSGGVSAKGLSVSRRNVYV
HKDQSPRGAEPAAKSAFGQLPSCATAGTEAGGARGTFHMGCGSPSFLTPSPGAERDAGAQ
ADRTPPWSDFAHQSRLPSPWVLRSEGRDAVWRGGVGSERDKGSEGPARGLPSLPLAGFSP
LLSTQLFHFGKGVSWGGRQAGLFSPHLGLPLQGPSFSAFREAQAGPSPVFGSPHLLAKKD
GGPWPTRKAQAGLSLHDRRSSGSEESILDLRYRRRVNRDDQEQDALGSDASDFSDTSTED
SGGSSVVKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T8A7	0.999	0.999	0.000	1209	1.000	1.000	Q5T8A7.pdb.gz	PPR26_HUMAN Protein phosphatase 1 regulatory subunit 26 OS=Homo sapiens OX=9606 GN=PPP1R26 PE=1 SV=1
2	AFDB:Q6PAC4	0.037	0.036	3.430E-5	1279	0.164	0.155	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
3	AFDB:P20676	0.031	0.033	1.187E-4	1076	0.153	0.172	P20676.pdb.gz	NUP1_YEAST Nucleoporin NUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP1 PE=1 SV=1
4	AFDB:Q86NP2	0.039	0.038	2.292E-4	1251	0.131	0.126	Q86NP2.pdb.gz	NELFA_DROME Negative elongation factor A OS=Drosophila melanogaster OX=7227 GN=Nelf-A PE=1 SV=2
5	AFDB:Q9C0A6	0.040	0.035	6.374E-4	1442	0.132	0.110	Q9C0A6.pdb.gz	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
6	AFDB:Q9W3E2	0.060	0.061	8.537E-4	1195	0.141	0.143	Q9W3E2.pdb.gz	PIP82_DROME Protein PIP82 OS=Drosophila melanogaster OX=7227 GN=PIP82 PE=1 SV=3
7	AFDB:Q6ZU65	0.042	0.032	1.323E-3	1347	0.160	0.143	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
8	AFDB:Q24079	0.053	0.052	1.532E-3	1221	0.147	0.146	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
9	AFDB:O13736	0.034	0.033	1.772E-3	1420	0.124	0.106	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
10	AFDB:Q9NSY1	0.036	0.037	1.907E-3	1161	0.106	0.110	Q9NSY1.pdb.gz	BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2
11	PDB:7f5sLT	0.027	0.158	7.956	159	0.013	0.101	7f5sLT.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
12	PDB:2ndjA	0.027	0.206	8.559	103	0.013	0.155	2ndjA.pdb.gz
13	PDB:6xywBD	0.027	0.112	8.559	210	0.012	0.071	6xywBD.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T8A7	0.0	2406	1209	1.000	1.000	PPR26_HUMAN Protein phosphatase 1 regulatory subunit 26 OS=Homo sapiens OX=9606 GN=PPP1R26 PE=1 SV=1
2	D3ZZ81	7.8	33.1	1190	0.031	0.032	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
3	A0A1B0GWM2	8.2	33.1	1218	0.031	0.031	A0A1B0GWM2_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
4	A0A1B0GWS0	8.3	33.1	1266	0.031	0.030	A0A1B0GWS0_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
5	A0A0G2K3L9	9.2	33.1	1142	0.031	0.033	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15740 PPP1R26_N	0	1280.5	Protein phosphatase 1 regulatory subunit 26 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349274

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320488	0.837	Nucleosome assembly protein 1 like 5
2	9606.ENSP00000362392	0.789	Cilia- and flagella-associated protein 157
3	9606.ENSP00000261637	0.773	Small subunit processome component 20 homolog
4	9606.ENSP00000310255	0.758	Probable G-protein coupled receptor 152
5	9606.ENSP00000379691	0.728	Pyridoxal-dependent decarboxylase domain-containing protein 1
6	9606.ENSP00000312615	0.722	Transmembrane protein 134
7	9606.ENSP00000400057	0.720	Isoaspartyl peptidase/L-asparaginase
8	9606.ENSP00000261721	0.701	BTB/POZ domain-containing protein 1
9	9606.ENSP00000324960	0.701	Calcium-binding protein 4
10	9606.ENSP00000360753	0.696	Epididymal-specific lipocalin-8
11	9606.ENSP00000254250	0.690	THAP domain-containing protein 1
12	9606.ENSP00000445725	0.689	E3 ubiquitin-protein ligase RNF170
13	9606.ENSP00000409799	0.678	Ribonuclease P protein subunit p21
14	9606.ENSP00000365844	0.665	E3 ubiquitin-protein ligase TRIM39
15	9606.ENSP00000228820	0.655	Poly [ADP-ribose] polymerase 11
16	9606.ENSP00000313833	0.637	Lipocalin-15
17	9606.ENSP00000330612	0.625	Mas-related G-protein coupled receptor member G
18	9606.ENSP00000348772	0.614	Membrane-associated phosphatidylinositol transfer protein 1
19	9606.ENSP00000375133	0.610	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1
20	9606.ENSP00000418661	0.610	peptidyl-tRNA hydrolase 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050789	0.980	regulation of biological process
GO:0009987	0.975	cellular process
GO:0050794	0.972	regulation of cellular process
GO:0071704	0.954	organic substance metabolic process
GO:0044238	0.947	primary metabolic process
GO:0006807	0.868	nitrogen compound metabolic process
GO:0044237	0.856	cellular metabolic process
GO:0019222	0.819	regulation of metabolic process
GO:0060255	0.779	regulation of macromolecule metabolic process
GO:0031323	0.713	regulation of cellular metabolic process
GO:0043170	0.707	macromolecule metabolic process
GO:0034641	0.702	cellular nitrogen compound metabolic process
GO:0006139	0.689	nucleobase-containing compound metabolic process
GO:0080090	0.684	regulation of primary metabolic process
GO:0051171	0.681	regulation of nitrogen compound metabolic process
GO:0019219	0.632	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.523	negative regulation of biological process
GO:0010468	0.441	regulation of gene expression
GO:0050896	0.440	response to stimulus
GO:0010556	0.385	regulation of macromolecule biosynthetic process
GO:0031326	0.384	regulation of cellular biosynthetic process
GO:0048518	0.356	positive regulation of biological process
GO:0048523	0.316	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0043233	0.995	organelle lumen
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0070013	0.981	intracellular organelle lumen
GO:0031981	0.957	nuclear lumen
GO:0005737	0.931	cytoplasm
GO:0032991	0.859	protein-containing complex
GO:0005654	0.705	nucleoplasm
GO:0005829	0.541	cytosol
GO:0005694	0.480	chromosome
GO:0016020	0.360	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]