StarFunc result for job id Q5T8P6

User Input

>input (1007 residues)
MVSKMIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVF
LQKETQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFPHQEKDIKKEEITKEEEREKKF
SRRLNHSPPQSSSRYRENRSRDERKKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYS
RSRSRSWSKERLRERDRDRSRTRSRSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVPS
ISSGHYPVPTLSSTITVIAPTHHGNNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEK
GFCMRGDMCPFDHGSDPVVVEDVNLPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNL
RPPVPPPGPLPPSLPPVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPP
SLFTADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSS
MRIVVDSESRKRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVP
PELNNISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRFIK
VYWHREGSTQQLQTTSPKVMQPLVQQPILPVVKQSVKERLGPVPSSTIEPAEAQSASSDL
PQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDN
NEAQKKKQEALKLQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSEDKAEIMKTLEVL
TKNITKLKDEVKAASPGRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTE
LQLEAAKRGILSSGRGRGIHSRGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTE
SDREDLLPHFAQYGEIEDCQIDDSSLHAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKP
VTNISAVETEEVEPDEEEFQEESLVDDSLLQDDDEEEEDNESRSWRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T8P6	1.000	1.000	0.000	1007	1.000	1.000	Q5T8P6.pdb.gz	RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3
2	AFDB:Q9P2N5	0.198	0.191	2.051E-61	1060	0.481	0.457	Q9P2N5.pdb.gz	RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2
3	AFDB:Q9VIV2	0.099	0.095	4.588E-51	1062	0.296	0.281	Q9VIV2.pdb.gz	SWM_DROME Zinc finger protein swm OS=Drosophila melanogaster OX=7227 GN=swm PE=1 SV=1
4	AFDB:S4R1W5	0.072	0.065	3.854E-4	1118	0.120	0.108	S4R1W5.pdb.gz	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
5	PDB:7r5jF0	0.069	0.273	4.569E-4	241	0.019	0.079	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
6	PDB:3pgwP	0.069	0.531	1.055E-3	113	0.016	0.142	3pgwP.pdb.gz
7	PDB:7oqcF	0.068	0.238	1.744E-3	267	0.017	0.064	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
8	PDB:6id0O	0.069	0.227	1.950E-3	290	0.023	0.079	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
9	PDB:6exnY	0.071	0.695	2.577E-3	87	0.023	0.264	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
10	PDB:6ff7X	0.071	0.373	3.047E-3	171	0.016	0.094	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	PDB:5gm6R	0.064	0.224	3.809E-3	261	0.015	0.057	5gm6R.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:5vsuA	0.072	0.181	3.809E-3	387	0.019	0.049	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	AFDB:D3ZRA6	0.072	0.046	4.017E-3	1683	0.139	0.083	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
14	PDB:5xjcw	0.065	0.600	4.259E-3	91	0.020	0.220	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
15	PDB:6n7pA	0.066	0.317	5.035E-3	186	0.028	0.151	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
16	AFDB:G5EG29	0.041	0.042	9.811E-3	968	0.119	0.124	G5EG29.pdb.gz	G5EG29_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
17	AFDB:Q4GYE7	0.058	0.040	1.621E-2	1638	0.144	0.089	Q4GYE7.pdb.gz	Q4GYE7_TRYB2 PDZ domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4310 PE=4 SV=1
18	AFDB:A0A0R4IJ26	0.081	0.049	2.996E-2	1760	0.102	0.059	A0A0R4IJ26.pdb.gz
19	AFDB:Q54DK4	0.053	0.042	2.996E-2	1352	0.094	0.070	Q54DK4.pdb.gz	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
20	AFDB:D7F2U9	0.077	0.090	3.745E-2	844	0.120	0.143	D7F2U9.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T8P6	0.0	2061	1007	1.000	1.000	RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3
2	Q9P2N5	4.14e-125	409	1060	0.287	0.273	RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2
3	Q9VIV2	4.72e-47	185	1062	0.145	0.137	SWM_DROME Zinc finger protein swm OS=Drosophila melanogaster OX=7227 GN=swm PE=1 SV=1
4	Q9USP9	2.24e-15	82.8	589	0.042	0.071	YHP4_SCHPO Uncharacterized RNA-binding protein C902.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC902.04 PE=1 SV=1
5	Q9LVX1	1.91e-10	67.4	908	0.029	0.032	C3H41_ARATH Zinc finger CCCH domain-containing protein 41 OS=Arabidopsis thaliana OX=3702 GN=At3g27700 PE=1 SV=1
6	Q9SKI0	0.014	41.2	291	0.034	0.117	Q9SKI0_ARATH At2g10940/F15K19.1 OS=Arabidopsis thaliana OX=3702 GN=At2g10940 PE=1 SV=1
7	F1QBY1	0.024	41.2	2876	0.035	0.012	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
8	Q9LFE0	0.062	39.7	820	0.028	0.034	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
9	Q9UDY2	0.075	39.7	1190	0.030	0.025	ZO2_HUMAN Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2
10	Q9VRM6	0.28	37.7	1929	0.030	0.016	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
11	Q5LJZ2	0.35	37.4	1641	0.053	0.032	SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1
12	Q96EV2	0.65	36.6	1170	0.030	0.026	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
13	Q6PGZ3	0.86	35.8	629	0.021	0.033	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
14	O14776	1.6	35.0	1098	0.034	0.031	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
15	Q9VJ87	1.6	35.0	1330	0.037	0.028	CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster OX=7227 GN=ncm PE=1 SV=3
16	F1RAH8	2.4	34.3	450	0.033	0.073	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
17	Q8VY15	3.3	34.3	899	0.028	0.031	RBM25_ARATH RNA-binding motif protein 25 OS=Arabidopsis thaliana OX=3702 GN=RBM25 PE=1 SV=1
18	Q4QRG7	5.0	33.1	434	0.035	0.081	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
19	A3KFF6	8.5	32.3	313	0.014	0.045	WBP2L_BOVIN Postacrosomal sheath WW domain-binding protein OS=Bos taurus OX=9913 GN=WBP2NL PE=2 SV=1
20	Q8C761	9.6	32.7	999	0.026	0.026	DC2I1_MOUSE Cytoplasmic dynein 2 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2i1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	0.016	26.6	Nup53/35/40-type RNA recognition motif
2	PF01480 PWI	8e-07	40.6	PWI domain
3	PF00076 RRM_1	4.1e-07	41.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF00642 zf-CCCH	3.1	19.1	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
5	PF18345 zf_CCCH_4	9.9	17.6	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013592

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012101	0.777	annotation not available
2	60711.ENSCSAP00000005325	0.726	Zinc finger CCCH-type containing 3
3	60711.ENSCSAP00000000456	0.705	Zinc finger, C3H1-type containing
4	60711.ENSCSAP00000006096	0.657	Src-like-adaptor
5	60711.ENSCSAP00000012450	0.583	Ski2 like RNA helicase 2
6	60711.ENSCSAP00000014344	0.580	THO complex 2
7	60711.ENSCSAP00000009574	0.570	Ring finger and CCCH-type domains 2
8	60711.ENSCSAP00000001539	0.556	RNA binding protein S1, serine-rich domain
9	60711.ENSCSAP00000015164	0.556	poly(A) binding protein, nuclear 1-like (cytoplasmic)
10	60711.ENSCSAP00000018412	0.540	Zinc finger CCCH-type containing 10
11	60711.ENSCSAP00000008738	0.523	Zinc finger CCCH-type containing 15
12	60711.ENSCSAP00000008146	0.521	Uncharacterized protein
13	60711.ENSCSAP00000004902	0.511	Zinc finger CCCH-type, antiviral 1-like
14	60711.ENSCSAP00000012338	0.511	YTH N6-methyladenosine RNA binding protein 1
15	60711.ENSCSAP00000010417	0.500	YTH N6-methyladenosine RNA binding protein 3
16	60711.ENSCSAP00000016994	0.500	YTH N6-methyladenosine RNA binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0008152	0.963	metabolic process
GO:0019222	0.950	regulation of metabolic process
GO:0071704	0.947	organic substance metabolic process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0051171	0.931	regulation of nitrogen compound metabolic process
GO:0080090	0.927	regulation of primary metabolic process
GO:0048519	0.923	negative regulation of biological process
GO:0006807	0.916	nitrogen compound metabolic process
GO:0010605	0.912	negative regulation of macromolecule metabolic process
GO:0031323	0.899	regulation of cellular metabolic process
GO:0010468	0.897	regulation of gene expression
GO:0051252	0.890	regulation of RNA metabolic process
GO:0044237	0.886	cellular metabolic process
GO:0044238	0.833	primary metabolic process
GO:0043170	0.804	macromolecule metabolic process
GO:0046483	0.743	heterocycle metabolic process
GO:0048523	0.724	negative regulation of cellular process
GO:0006139	0.655	nucleobase-containing compound metabolic process
GO:0010467	0.642	gene expression
GO:0010556	0.613	regulation of macromolecule biosynthetic process
GO:0090304	0.586	nucleic acid metabolic process
GO:0016070	0.584	RNA metabolic process
GO:0031324	0.488	negative regulation of cellular metabolic process
GO:0051172	0.472	negative regulation of nitrogen compound metabolic process
GO:0048518	0.441	positive regulation of biological process
GO:0006396	0.352	RNA processing
GO:0031326	0.340	regulation of cellular biosynthetic process
GO:0051253	0.326	negative regulation of RNA metabolic process
GO:0048522	0.317	positive regulation of cellular process
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.993	nuclear body
GO:0005737	0.849	cytoplasm
GO:0032991	0.408	protein-containing complex
GO:0016607	0.385	nuclear speck
GO:0043232	0.338	intracellular non-membrane-bounded organelle
GO:0005829	0.332	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]