StarFunc result for job id Q5T9C9

User Input

>input (394 residues)
MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQ
AGLWAATQVSMDHPPTGPPSRDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEEDYQ
AALGPGGPYLQFLSTSKSKASFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHS
LLARLLGVHSLRVDRGKKTYFIVMQSVFYPAGRISERYDIKGCEVSRWVDPAPEGSPLVL
VLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSL
IFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLATVYGLRKRLE
HLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T9C9	1.000	1.000	3.350E-81	394	1.000	1.000	Q5T9C9.pdb.gz	PI5L1_HUMAN Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Homo sapiens OX=9606 GN=PIP5KL1 PE=2 SV=2
2	AFDB:Q6U7H8	0.890	0.888	1.549E-60	395	0.728	0.727	Q6U7H8.pdb.gz	PI5L1_MOUSE Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Mus musculus OX=10090 GN=Pip5kl1 PE=1 SV=1
3	AFDB:O13853	0.709	0.393	9.721E-29	742	0.266	0.142	O13853.pdb.gz	ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=its3 PE=1 SV=3
4	AFDB:Q86A02	0.742	0.195	1.215E-28	1589	0.251	0.062	Q86A02.pdb.gz	Q86A02_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=PIPkinA PE=4 SV=1
5	AFDB:A0A1D8PJ31	0.718	0.405	2.346E-27	718	0.282	0.155	A0A1D8PJ31.pdb.gz	A0A1D8PJ31_CANAL 1-phosphatidylinositol-4-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSS4 PE=4 SV=1
6	AFDB:Q55GN6	0.741	0.419	4.336E-27	719	0.297	0.163	Q55GN6.pdb.gz	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1
7	AFDB:O48709	0.734	0.421	8.014E-27	705	0.259	0.145	O48709.pdb.gz	PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=PIP5K3 PE=4 SV=1
8	AFDB:Q8TBX8	0.684	0.643	1.751E-26	421	0.254	0.238	Q8TBX8.pdb.gz	PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens OX=9606 GN=PIP4K2C PE=1 SV=3
9	AFDB:P38994	0.718	0.377	2.071E-26	779	0.269	0.136	P38994.pdb.gz	MSS4_YEAST Phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS4 PE=1 SV=2
10	AFDB:P78356	0.708	0.672	4.280E-26	416	0.234	0.221	P78356.pdb.gz	PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1
11	PDB:1bo1A	0.635	0.759	1.843E-21	326	0.206	0.248	1bo1A.pdb.gz
12	PDB:6ym4A	0.613	0.740	6.658E-21	322	0.198	0.242	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
13	PDB:7n81B	0.578	0.729	4.098E-18	307	0.188	0.241	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
14	PDB:7em5B	0.592	0.775	5.124E-18	297	0.175	0.232	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
15	PDB:2gk9B	0.511	0.781	9.934E-13	250	0.175	0.276	2gk9B.pdb.gz
16	PDB:4o7pB	0.170	0.154	6.901E-2	451	0.099	0.086	4o7pB.pdb.gz	Homotypic dimerization of a maltose kinase for molecular scaffolding.
17	PDB:6dflA	0.189	0.274	8.160E-2	241	0.061	0.100	6dflA.pdb.gz	Acylated-acyl carrier protein stabilizes the Pseudomonas aeruginosa WaaP lipopolysaccharide heptose kinase.
18	PDB:6fadC	0.259	0.279	8.160E-2	359	0.089	0.097	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
19	PDB:1zylA	0.179	0.210	2.109E-1	325	0.102	0.123	1zylA.pdb.gz
20	PDB:6s9wA	0.190	0.183	2.358E-1	411	0.074	0.071	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T9C9	0.0	805	394	1.000	1.000	PI5L1_HUMAN Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Homo sapiens OX=9606 GN=PIP5KL1 PE=2 SV=2
2	Q6U7H8	0.0	594	395	0.731	0.729	PI5L1_MOUSE Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Mus musculus OX=10090 GN=Pip5kl1 PE=1 SV=1
3	Q55GN6	2.23e-38	148	719	0.261	0.143	Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0267588 PE=1 SV=1
4	O48709	1.58e-34	137	705	0.228	0.128	PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana OX=3702 GN=PIP5K3 PE=4 SV=1
5	O13853	1.27e-31	129	742	0.279	0.148	ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=its3 PE=1 SV=3
6	A0A1D8PJ31	1.62e-30	125	718	0.277	0.152	A0A1D8PJ31_CANAL 1-phosphatidylinositol-4-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSS4 PE=4 SV=1
7	Q9SLG9	1.22e-28	120	772	0.213	0.109	PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5 OS=Arabidopsis thaliana OX=3702 GN=PIP5K5 PE=2 SV=1
8	P38994	1.31e-28	120	779	0.218	0.110	MSS4_YEAST Phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSS4 PE=1 SV=2
9	Q86A02	4.21e-28	119	1589	0.236	0.059	Q86A02_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=PIPkinA PE=4 SV=1
10	Q9M1K2	4.87e-27	115	779	0.221	0.112	PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana OX=3702 GN=PIP5K4 PE=4 SV=1
11	Q8L796	5.62e-27	115	754	0.231	0.121	PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PIP5K2 PE=1 SV=2
12	Q9SFB8	9.93e-27	114	715	0.216	0.119	PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana OX=3702 GN=PIP5K6 PE=2 SV=1
13	Q503I3	1.60e-26	113	559	0.221	0.156	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
14	Q56YP2	1.71e-26	114	752	0.236	0.124	PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PIP5K1 PE=1 SV=1
15	Q8I239	3.34e-26	113	1710	0.223	0.051	PI51N_PLAF7 Phosphatidylinositol 4-phosphate 5-kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PIP5K PE=1 SV=1
16	P70181	2.03e-25	110	539	0.228	0.167	PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1
17	Q8L850	2.03e-25	110	815	0.160	0.077	PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9 OS=Arabidopsis thaliana OX=3702 GN=PIP5K9 PE=1 SV=2
18	A6PW57	3.79e-24	106	550	0.213	0.153	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
19	Q99755	4.48e-24	106	562	0.213	0.149	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
20	Q8SXX1	1.77e-23	103	404	0.226	0.220	Q8SXX1_DROME Phosphatidylinositol 5-phosphate 4-kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=PIP4K PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	4.3e-61	218.2	Phosphatidylinositol-4-phosphate 5-Kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373399

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366563	0.970	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
2	9606.ENSP00000289153	0.949	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
3	9606.ENSP00000367747	0.948	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
4	9606.ENSP00000388631	0.946	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
5	9606.ENSP00000266505	0.944	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
6	9606.ENSP00000345988	0.942	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
7	9606.ENSP00000479636	0.938	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
8	9606.ENSP00000255882	0.937	Phosphatidylinositol 4-kinase alpha
9	9606.ENSP00000357869	0.937	Phosphatidylinositol 4-kinase beta
10	9606.ENSP00000373713	0.937	Phosphatidylinositide phosphatase SAC1
11	9606.ENSP00000352121	0.935	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
12	9606.ENSP00000430344	0.935	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
13	9606.ENSP00000263967	0.933	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
14	9606.ENSP00000443631	0.933	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
15	9606.ENSP00000360431	0.930	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
16	9606.ENSP00000367762	0.928	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
17	9606.ENSP00000354519	0.927	Phosphatidylinositide phosphatase SAC2
18	9606.ENSP00000260402	0.923	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
19	9606.ENSP00000338185	0.921	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
20	9606.ENSP00000482457	0.920	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016308	1.000	1-phosphatidylinositol-4-phosphate 5-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0065008	0.972	regulation of biological quality
GO:0040012	0.937	regulation of locomotion
GO:0080090	0.916	regulation of primary metabolic process
GO:0010941	0.916	regulation of cell death
GO:0060255	0.893	regulation of macromolecule metabolic process
GO:0051174	0.883	regulation of phosphorus metabolic process
GO:0048522	0.881	positive regulation of cellular process
GO:2000145	0.878	regulation of cell motility
GO:0048519	0.863	negative regulation of biological process
GO:0051171	0.853	regulation of nitrogen compound metabolic process
GO:0051881	0.846	regulation of mitochondrial membrane potential
GO:0009987	0.813	cellular process
GO:0010942	0.806	positive regulation of cell death
GO:0042325	0.803	regulation of phosphorylation
GO:0043067	0.795	regulation of programmed cell death
GO:0031400	0.775	negative regulation of protein modification process
GO:0042981	0.752	regulation of apoptotic process
GO:0044237	0.746	cellular metabolic process
GO:0042326	0.723	negative regulation of phosphorylation
GO:0040013	0.718	negative regulation of locomotion
GO:0001932	0.699	regulation of protein phosphorylation
GO:0030334	0.678	regulation of cell migration
GO:0071704	0.629	organic substance metabolic process
GO:0043068	0.622	positive regulation of programmed cell death
GO:0044238	0.620	primary metabolic process
GO:0043065	0.580	positive regulation of apoptotic process
GO:2000146	0.577	negative regulation of cell motility
GO:0006793	0.575	phosphorus metabolic process
GO:0006796	0.574	phosphate-containing compound metabolic process
GO:0046488	0.556	phosphatidylinositol metabolic process
GO:0001933	0.493	negative regulation of protein phosphorylation
GO:0046474	0.425	glycerophospholipid biosynthetic process
GO:0006661	0.406	phosphatidylinositol biosynthetic process
GO:0048583	0.332	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.736	organelle
GO:0043227	0.657	membrane-bounded organelle
GO:0043229	0.496	intracellular organelle
GO:0016020	0.333	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	1.000	1-phosphatidylinositol-4-phosphate 5-kinase.

[back to server]