StarFunc result for job id Q5T9L3

User Input

>input (541 residues)
MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKT
KWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAF
KLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECD
VLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTF
LTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFG
DIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
LTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGM
WNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQ
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T9L3	1.000	1.000	1.639E-98	541	1.000	1.000	Q5T9L3.pdb.gz	WLS_HUMAN Protein wntless homolog OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=2
2	AFDB:F2Z4U3	0.899	0.898	1.941E-77	542	0.782	0.780	F2Z4U3.pdb.gz	F2Z4U3_DANRE Protein wntless homolog OS=Danio rerio OX=7955 GN=gpr117 PE=1 SV=1
3	AFDB:Q5FWK6	0.878	0.878	6.259E-76	541	0.745	0.745	Q5FWK6.pdb.gz	WLSB_XENLA Protein wntless homolog B OS=Xenopus laevis OX=8355 GN=wls-b PE=2 SV=1
4	PDB:7drtB	0.837	0.910	1.054E-75	496	0.917	1.000	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
5	AFDB:Q95ST2	0.842	0.770	1.729E-50	594	0.436	0.397	Q95ST2.pdb.gz	WLS_DROME Protein wntless OS=Drosophila melanogaster OX=7227 GN=wls PE=1 SV=1
6	AFDB:Q7YWX7	0.823	0.812	6.053E-48	549	0.379	0.373	Q7YWX7.pdb.gz	WLS_CAEEL Protein wntless homolog OS=Caenorhabditis elegans OX=6239 GN=mig-14 PE=1 SV=1
7	AFDB:Q9P2C4	0.621	0.555	1.274E-19	612	0.152	0.134	Q9P2C4.pdb.gz	TM181_HUMAN Transmembrane protein 181 OS=Homo sapiens OX=9606 GN=TMEM181 PE=1 SV=2
8	AFDB:Q57WC3	0.512	0.253	6.932E-11	1232	0.115	0.050	Q57WC3.pdb.gz	Q57WC3_TRYB2 Lipase domain protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.580 PE=4 SV=1
9	AFDB:F4JY11	0.320	0.374	3.488E-8	440	0.102	0.125	F4JY11.pdb.gz	CAND7_ARATH Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 7 OS=Arabidopsis thaliana OX=3702 GN=CAND7 PE=2 SV=1
10	AFDB:Q8GYD0	0.294	0.305	1.149E-7	513	0.109	0.115	Q8GYD0.pdb.gz	Q8GYD0_ARATH Lung seven transmembrane receptor family protein OS=Arabidopsis thaliana OX=3702 GN=At1g61670 PE=1 SV=1
11	AFDB:F4IM73	0.334	0.357	1.414E-7	496	0.126	0.137	F4IM73.pdb.gz	F4IM73_ARATH Lung seven transmembrane receptor family protein OS=Arabidopsis thaliana OX=3702 GN=At2g01070 PE=1 SV=1
12	PDB:7w2zR	0.303	0.480	6.984E-4	301	0.054	0.096	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
13	PDB:7e32R	0.306	0.511	8.159E-4	285	0.067	0.126	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
14	PDB:7td1R	0.236	0.375	9.051E-4	293	0.061	0.113	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
15	PDB:7wq3R	0.296	0.488	9.532E-4	289	0.059	0.111	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
16	PDB:6ibbA	0.250	0.401	1.057E-3	301	0.054	0.096	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
17	PDB:7f1qR	0.275	0.370	1.443E-3	367	0.055	0.082	7f1qR.pdb.gz
18	PDB:7wv9R	0.310	0.516	2.688E-3	290	0.061	0.114	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
19	PDB:8ef5M	0.276	0.467	2.831E-3	288	0.068	0.128	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
20	PDB:7sqoR	0.330	0.584	3.308E-3	270	0.057	0.115	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F2Z4U3	0.0	912	542	0.782	0.780	F2Z4U3_DANRE Protein wntless homolog OS=Danio rerio OX=7955 GN=gpr117 PE=1 SV=1
2	Q5FWK6	0.0	843	541	0.745	0.745	WLSB_XENLA Protein wntless homolog B OS=Xenopus laevis OX=8355 GN=wls-b PE=2 SV=1
3	Q5T9L3	0.0	1123	541	1.000	1.000	WLS_HUMAN Protein wntless homolog OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=2
4	Q6DID7	0.0	1091	541	0.961	0.961	WLS_MOUSE Protein wntless homolog OS=Mus musculus OX=10090 GN=Wls PE=1 SV=1
5	Q6P689	0.0	1087	541	0.957	0.957	WLS_RAT Protein wntless homolog OS=Rattus norvegicus OX=10116 GN=Wls PE=1 SV=1
6	Q7T357	0.0	911	542	0.782	0.780	Q7T357_DANRE G protein-coupled receptor 177 OS=Danio rerio OX=7955 GN=gpr177 PE=2 SV=2
7	E9PM62	3.99e-165	469	222	0.410	1.000	E9PM62_HUMAN Wnt ligand secretion mediator (Fragment) OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=1
8	Q95ST2	1.94e-156	461	594	0.444	0.404	WLS_DROME Protein wntless OS=Drosophila melanogaster OX=7227 GN=wls PE=1 SV=1
9	H0YCG9	1.54e-123	362	200	0.325	0.880	H0YCG9_HUMAN Wnt ligand secretion mediator (Fragment) OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=1
10	Q7YWX7	1.31e-121	370	549	0.370	0.364	WLS_CAEEL Protein wntless homolog OS=Caenorhabditis elegans OX=6239 GN=mig-14 PE=1 SV=1
11	E9PJW4	1.30e-93	283	134	0.248	1.000	E9PJW4_HUMAN Wnt ligand secretion mediator (Fragment) OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=1
12	E9PKJ0	1.81e-84	259	122	0.226	1.000	E9PKJ0_HUMAN Wnt ligand secretion mediator (Fragment) OS=Homo sapiens OX=9606 GN=WLS PE=1 SV=1
13	Q9P2C4	1.10e-07	57.0	612	0.109	0.096	TM181_HUMAN Transmembrane protein 181 OS=Homo sapiens OX=9606 GN=TMEM181 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06664 MIG-14_Wnt-bd	1.3e-90	315.2	Wnt-binding factor required for Wnt secretion

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003807917.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003825868.1	0.966	Ligand for members of the frizzled family of seven transmembrane receptors
2	9597.XP_008962130.1	0.960	Belongs to the G-protein coupled receptor 1 family.
3	9597.XP_003819836.1	0.886	VPS35, retromer complex component
4	9597.XP_003808686.1	0.881	Ligand for members of the frizzled family of seven transmembrane receptors
5	9597.XP_008970521.1	0.875	Ligand for members of the frizzled family of seven transmembrane receptors
6	9597.XP_008962208.1	0.873	Ligand for members of the frizzled family of seven transmembrane receptors
7	9597.XP_003825519.1	0.842	Ligand for members of the frizzled family of seven transmembrane receptors
8	9597.XP_008952856.1	0.842	Ligand for members of the frizzled family of seven transmembrane receptors
9	9597.XP_008961913.1	0.841	Ligand for members of the frizzled family of seven transmembrane receptors
10	9597.XP_008966074.1	0.839	Ligand for members of the frizzled family of seven transmembrane receptors
11	9597.XP_008964808.1	0.836	Ligand for members of the frizzled family of seven transmembrane receptors
12	9597.XP_008956145.1	0.832	Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway
13	9597.XP_003820197.1	0.822	Sorting nexin-12
14	9597.XP_008970222.1	0.817	Ligand for members of the frizzled family of seven transmembrane receptors
15	9597.XP_008970292.1	0.814	Ligand for members of the frizzled family of seven transmembrane receptors
16	9597.XP_003808698.1	0.813	Ligand for members of the frizzled family of seven transmembrane receptors
17	9597.XP_008972051.1	0.812	Ligand for members of the frizzled family of seven transmembrane receptors
18	9597.XP_003804860.1	0.811	Ligand for members of the frizzled family of seven transmembrane receptors
19	9597.XP_003824375.1	0.804	Sorting nexin 3
20	9597.XP_003814758.1	0.799	Ligand for members of the frizzled family of seven transmembrane receptors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0042802	0.722	identical protein binding
GO:0001664	0.536	G protein-coupled receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0032502	0.972	developmental process
GO:0048513	0.961	animal organ development
GO:0007275	0.958	multicellular organism development
GO:0030111	0.935	regulation of Wnt signaling pathway
GO:0051239	0.922	regulation of multicellular organismal process
GO:0009987	0.916	cellular process
GO:0060322	0.910	head development
GO:0048522	0.910	positive regulation of cellular process
GO:0007267	0.904	cell-cell signaling
GO:0048731	0.885	system development
GO:0007399	0.882	nervous system development
GO:0009653	0.874	anatomical structure morphogenesis
GO:0001503	0.843	ossification
GO:0198738	0.842	cell-cell signaling by wnt
GO:0001501	0.839	skeletal system development
GO:0009887	0.832	animal organ morphogenesis
GO:0009888	0.829	tissue development
GO:0022603	0.819	regulation of anatomical structure morphogenesis
GO:0051128	0.808	regulation of cellular component organization
GO:0009790	0.801	embryo development
GO:0007417	0.800	central nervous system development
GO:0007389	0.782	pattern specification process
GO:0007423	0.773	sensory organ development
GO:0003002	0.758	regionalization
GO:0048705	0.754	skeletal system morphogenesis
GO:0051216	0.708	cartilage development
GO:0048706	0.702	embryonic skeletal system development
GO:0043583	0.700	ear development
GO:0021536	0.697	diencephalon development
GO:0051179	0.691	localization
GO:0030177	0.690	positive regulation of Wnt signaling pathway
GO:0048839	0.688	inner ear development
GO:0060348	0.684	bone development
GO:2000026	0.676	regulation of multicellular organismal development
GO:0036075	0.673	replacement ossification
GO:0060349	0.665	bone morphogenesis
GO:1903532	0.663	positive regulation of secretion by cell
GO:0001958	0.659	endochondral ossification
GO:1903829	0.653	positive regulation of protein localization
GO:0021915	0.646	neural tube development
GO:0051234	0.638	establishment of localization
GO:1904888	0.630	cranial skeletal system development
GO:0048704	0.625	embryonic skeletal system morphogenesis
GO:0021903	0.619	rostrocaudal neural tube patterning
GO:0006810	0.618	transport
GO:0021538	0.615	epithalamus development
GO:0060536	0.615	cartilage morphogenesis
GO:0030917	0.614	midbrain-hindbrain boundary development
GO:0060872	0.608	semicircular canal development
GO:0033036	0.602	macromolecule localization
GO:0048701	0.594	embryonic cranial skeleton morphogenesis
GO:0051641	0.586	cellular localization
GO:0060828	0.566	regulation of canonical Wnt signaling pathway
GO:0048703	0.565	embryonic viscerocranium morphogenesis
GO:0008283	0.534	cell population proliferation
GO:0071692	0.530	protein localization to extracellular region
GO:1904951	0.529	positive regulation of establishment of protein localization
GO:0046903	0.511	secretion
GO:0051223	0.507	regulation of protein transport
GO:0051222	0.499	positive regulation of protein transport
GO:0035592	0.482	establishment of protein localization to extracellular region
GO:0051130	0.477	positive regulation of cellular component organization
GO:0001775	0.472	cell activation
GO:0009306	0.467	protein secretion
GO:0023061	0.465	signal release
GO:0090263	0.450	positive regulation of canonical Wnt signaling pathway
GO:0001654	0.422	eye development
GO:0050708	0.418	regulation of protein secretion
GO:0050714	0.410	positive regulation of protein secretion
GO:0050896	0.339	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0031410	0.976	cytoplasmic vesicle
GO:0005794	0.934	Golgi apparatus
GO:0005576	0.932	extracellular region
GO:0005615	0.888	extracellular space
GO:0031090	0.843	organelle membrane
GO:0005783	0.787	endoplasmic reticulum
GO:0005829	0.786	cytosol
GO:0098588	0.703	bounding membrane of organelle
GO:0005768	0.593	endosome
GO:1903561	0.529	extracellular vesicle
GO:0070062	0.521	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]