StarFunc result for job id Q5T9S5

User Input

>input (1454 residues)
MESSSSDYYNKDNEEESLLANVASLRHELKITEWSLQSLGEELSSVSPSENSDYAPNPSR
SEKLILDVQPSHPGLLNYSPYENVCKISGSSTDFQKKPRDKMFSSSAPVDQEIKSLREKL
NKLRQQNACLVTQNHSLMTKFESIHFELTQSRAKVSMLESAQQQAASVPILEEQIINLEA
EVSAQDKVLREAENKLEQSQKMVIEKEQSLQESKEECIKLKVDLLEQTKQGKRAERQRNE
ALYNAEELSKAFQQYKKKVAEKLEKVQAEEEILERNLTNCEKENKRLQERCGLYKSELEI
LKEKLRQLKEENNNGKEKLRIMAVKNSEVMAQLTESRQSILKLESELENKDEILRDKFSL
MNENRELKVRVAAQNERLDLCQQEIESSRVELRSLEKIISQLPLKRELFGFKSYLSKYQM
SSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSD
LKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKIVAYSSIAAK
NAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLEK
KDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKENMKKDEALKALQNQVSE
ETIKVRQLDSALEICKEELVLHLNQLEGNKEKFEKQLKKKSEEVYCLQKELKIKNHSLQE
TSEQNVILQHTLQQQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRK
MEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGENKAMH
LSQLDMILDQTKTELEKKTNAVKELEKLQHSTETELTEALQKREVLETELQNAHGELKST
LRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMDQALKERNWEL
KQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQL
REKEFIMLQNEQEISQLKKEIERTQQRMKEMESVMKEQEQYIATQYKEAIDLGQELRLTR
EQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASKVREA
HLEARMQAEIKKLSAEVESLKEAYHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAK
LELEEAQDTVSNLHQQVQDRNEVIEAANEALLTKESELTRLQAKISGHEKAEDIKFLPAP
FTSPTEIMPDVQDPKFAKCFHTSFSKCTKLRRSISASDLTFKIHGDEDLSEELLQDLKKM
QLEQPSTLEESHKNLTYTQPDSFKPLTYNLEADSSENNDFNTLSGMLRYINKEVRLLKKS
SMQTGAGLNQGENV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T9S5	1.000	1.000	0.000	1454	1.000	1.000	Q5T9S5.pdb.gz	CCD18_HUMAN Coiled-coil domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CCDC18 PE=1 SV=1
2	AFDB:Q57Z65	0.081	0.098	2.992E-4	1188	0.074	0.091	Q57Z65.pdb.gz	Q57Z65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.380 PE=4 SV=1
3	AFDB:F4JIF4	0.085	0.073	6.971E-4	1710	0.186	0.158	F4JIF4.pdb.gz	NET1B_ARATH Protein NETWORKED 1B OS=Arabidopsis thaliana OX=3702 GN=NET1B PE=2 SV=1
4	AFDB:Q8IUG5	0.064	0.041	8.129E-4	2567	0.113	0.064	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
5	AFDB:Q54JG6	0.096	0.072	1.290E-3	2037	0.195	0.139	Q54JG6.pdb.gz	Q54JG6_DICDI Nucleoprotein TPR/MLP1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288073 PE=4 SV=1
6	AFDB:Q66GS9	0.115	0.142	2.385E-3	1140	0.124	0.159	Q66GS9.pdb.gz	CP135_HUMAN Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2
7	AFDB:A4GSN8	0.126	0.092	2.782E-3	2093	0.184	0.128	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
8	AFDB:A0A0B4J1F9	0.085	0.078	3.784E-3	1599	0.178	0.162	A0A0B4J1F9.pdb.gz	A0A0B4J1F9_MOUSE Trichohyalin OS=Mus musculus OX=10090 GN=Tchh PE=1 SV=1
9	AFDB:Q96CN9	0.099	0.171	4.413E-3	775	0.069	0.130	Q96CN9.pdb.gz	GCC1_HUMAN GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1
10	AFDB:F4JJP1	0.074	0.086	7.560E-3	1221	0.178	0.212	F4JJP1.pdb.gz	Y4759_ARATH WEB family protein At4g27595, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g27595 PE=2 SV=1
11	PDB:3jb9M	0.025	0.125	1.477	207	0.020	0.140	3jb9M.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:6ud7D	0.022	0.282	6.874	73	0.006	0.110	6ud7D.pdb.gz	Structural basis of indisulam-mediated RBM39 recruitment to DCAF15 E3 ligase complex.
13	PDB:6wotA	0.019	0.007	6.874	4197	0.007	0.002	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
14	PDB:5xtcj	0.021	0.179	7.423	115	0.013	0.165	5xtcj.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:6hivCv	0.019	0.025	9.349	1059	0.006	0.008	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T9S5	0.0	2891	1454	1.000	1.000	CCD18_HUMAN Coiled-coil domain-containing protein 18 OS=Homo sapiens OX=9606 GN=CCDC18 PE=1 SV=1
2	H2L0I2	0.003	45.1	2396	0.096	0.058	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
3	H2L0I4	0.003	44.7	2392	0.096	0.059	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
4	E7EYJ3	0.004	44.3	903	0.056	0.091	E7EYJ3_DANRE Hyaluronan-mediated motility receptor (RHAMM) OS=Danio rerio OX=7955 GN=wu:fb43e12 PE=4 SV=4
5	H2L0I3	0.006	43.9	2323	0.096	0.060	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
6	P25386	0.010	43.1	1790	0.099	0.080	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
7	Q57UV7	0.021	42.0	1456	0.080	0.080	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
8	Q8K4T4	0.27	38.1	1212	0.083	0.099	FLIP1_RAT Filamin-A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Filip1 PE=1 SV=1
9	B3RH40	0.34	38.1	1255	0.029	0.033	B3RH40_MEDTR Myosin heavy chain-like protein, putative OS=Medicago truncatula OX=3880 GN=25484843 PE=4 SV=1
10	Q1D823	0.61	37.4	1395	0.063	0.066	AGLZ_MYXXD Adventurous-gliding motility protein Z OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=aglZ PE=1 SV=1
11	Q8BIJ7	0.83	36.6	712	0.041	0.084	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
12	Q02224	1.2	36.2	2701	0.043	0.023	CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2
13	B1AR69	1.4	35.8	1938	0.096	0.072	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
14	Q06704	1.8	35.4	911	0.050	0.079	IMH1_YEAST Golgin IMH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMH1 PE=1 SV=1
15	A0A1U9X7G6	1.9	35.4	835	0.025	0.044	A0A1U9X7G6_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 PE=4 SV=1
16	Q8TD31	2.1	35.4	782	0.025	0.047	CCHCR_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 GN=CCHCR1 PE=1 SV=2
17	A2ABH1	2.2	35.0	729	0.025	0.051	A2ABH1_HUMAN Coiled-coil alpha-helical rod protein 1 OS=Homo sapiens OX=9606 GN=CCHCR1 PE=1 SV=1
18	Q9CS72	2.2	35.4	1214	0.089	0.106	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
19	P93203	3.2	34.7	697	0.073	0.152	MFP1_SOLLC MAR-binding filament-like protein 1 OS=Solanum lycopersicum OX=4081 GN=MFP1 PE=1 SV=1
20	Q9ZQX8	3.3	34.7	1111	0.031	0.041	NET1C_ARATH Protein NETWORKED 1C OS=Arabidopsis thaliana OX=3702 GN=NET1C PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000001329

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000015416	0.654	Pongo abelii coiled-coil domain containing 66 (CCDC66), mRNA
2	9601.ENSPPYP00000015632	0.644	Coiled-coil domain containing 13
3	9601.ENSPPYP00000015139	0.630	Regulator required for centriole duplication, for proper bipolar spindle formation and chromosome congression in mitosis.
4	9601.ENSPPYP00000004352	0.611	Centrosomal protein 126
5	9601.ENSPPYP00000006167	0.572	Progesterone immunomodulatory binding factor 1
6	9601.ENSPPYP00000005894	0.570	Cancer susceptibility candidate protein 1
7	9601.ENSPPYP00000008868	0.563	KIAA0753
8	9601.ENSPPYP00000013714	0.557	Protease-associated domain containing 1
9	9601.ENSPPYP00000003150	0.555	Sideroflexin 4
10	9601.ENSPPYP00000015576	0.555	Coiled-coil domain containing 12
11	9601.ENSPPYP00000009578	0.554	LIM domain containing 2
12	9601.ENSPPYP00000023627	0.554	Cilia and flagella associated protein 36
13	9601.ENSPPYP00000015065	0.535	Coiled-coil domain containing 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.879	regulation of cellular process
GO:0071840	0.775	cellular component organization or biogenesis
GO:0016043	0.764	cellular component organization
GO:0006996	0.471	organelle organization
GO:0007017	0.362	microtubule-based process
GO:0120035	0.348	regulation of plasma membrane bounded cell projection organization
GO:0007010	0.345	cytoskeleton organization
GO:0022414	0.344	reproductive process
GO:0060491	0.303	regulation of cell projection assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034451	0.998	centriolar satellite
GO:0005737	0.932	cytoplasm
GO:0043227	0.902	membrane-bounded organelle
GO:0043231	0.784	intracellular membrane-bounded organelle
GO:0005634	0.422	nucleus
GO:0005829	0.367	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]