StarFunc result for job id Q5TA31

User Input

>input (235 residues)
MALPAGPAEAACALCQRAPREPVRADCGHRFCRACVVRFWAEEDGPFPCPECADDCWQRA
VEPGRPPLSRRLLALEEAAAAPARDGPASEAALQLLCRADAGPLCAACRMAAGPEPPEWE
PRWRKALRGKENKGSVEIMRKDLNDARDLHGQAESAAAVWKGHVMDRRKKALTDYKKLRA
FFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BFX1	0.476	0.474	4.171E-32	236	0.949	0.945	Q8BFX1.pdb.gz	RN187_MOUSE E3 ubiquitin-protein ligase RNF187 OS=Mus musculus OX=10090 GN=Rnf187 PE=1 SV=2
2	AFDB:Q99PQ2	0.361	0.201	7.837E-8	467	0.294	0.148	Q99PQ2.pdb.gz	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
3	AFDB:Q96F44	0.368	0.206	2.462E-7	468	0.289	0.145	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
4	AFDB:Q9Y577	0.336	0.182	1.986E-6	477	0.298	0.147	Q9Y577.pdb.gz	TRI17_HUMAN E3 ubiquitin-protein ligase TRIM17 OS=Homo sapiens OX=9606 GN=TRIM17 PE=1 SV=1
5	AFDB:Q5D7I0	0.358	0.184	6.674E-6	494	0.226	0.107	Q5D7I0.pdb.gz	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
6	AFDB:Q587N6	0.398	0.213	7.139E-6	495	0.217	0.103	Q587N6.pdb.gz	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
7	AFDB:Q8C006	0.357	0.195	8.737E-6	501	0.251	0.118	Q8C006.pdb.gz	TRI35_MOUSE E3 ubiquitin-protein ligase TRIM35 OS=Mus musculus OX=10090 GN=Trim35 PE=1 SV=2
8	AFDB:Q495X7	0.355	0.203	1.069E-5	471	0.251	0.125	Q495X7.pdb.gz	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
9	AFDB:A0A024RCP5	0.344	0.172	1.144E-5	518	0.221	0.100	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
10	AFDB:A0A024RCR1	0.344	0.183	1.144E-5	488	0.234	0.113	A0A024RCR1.pdb.gz
11	PDB:5dkaA	0.172	0.406	1.944E-3	96	0.068	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:5l9uB	0.192	0.585	1.794E-2	71	0.051	0.169	5l9uB.pdb.gz
13	PDB:5gm6a	0.174	0.320	2.688E-2	123	0.064	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:4r8pL	0.195	0.182	7.380E-2	254	0.081	0.075	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:5a31B	0.196	0.509	7.894E-2	84	0.043	0.119	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:2lgvA	0.149	0.329	2.653E-1	100	0.043	0.100	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
17	PDB:8a3tU	0.172	0.330	3.974E-1	114	0.077	0.158	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	PDB:7oikA	0.174	0.012	5.564E-1	4426	0.081	0.004	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
19	PDB:7oniR	0.173	0.437	6.810E-1	86	0.060	0.163	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
20	PDB:7qcdC	0.183	0.163	7.792E-1	267	0.047	0.041	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TA31	5.25e-168	464	235	1.000	1.000	RN187_HUMAN E3 ubiquitin-protein ligase RNF187 OS=Homo sapiens OX=9606 GN=RNF187 PE=1 SV=2
2	A0A1X7SBW3	2.05e-167	462	235	0.996	0.996	A0A1X7SBW3_HUMAN E3 ubiquitin-protein ligase RNF187 OS=Homo sapiens OX=9606 GN=RNF187 PE=1 SV=1
3	Q8BFX1	1.89e-147	412	236	0.953	0.949	RN187_MOUSE E3 ubiquitin-protein ligase RNF187 OS=Mus musculus OX=10090 GN=Rnf187 PE=1 SV=2
4	Q99PQ2	1.30e-21	94.7	467	0.255	0.128	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
5	Q96F44	5.98e-21	92.8	468	0.255	0.128	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
6	Q9Y577	1.87e-19	88.6	477	0.260	0.128	TRI17_HUMAN E3 ubiquitin-protein ligase TRIM17 OS=Homo sapiens OX=9606 GN=TRIM17 PE=1 SV=1
7	A2AAZ6	1.46e-16	78.6	260	0.281	0.254	A2AAZ6_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=8
8	A0A096LP39	5.23e-16	78.6	503	0.277	0.129	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
9	Q9C037	6.48e-16	78.6	500	0.294	0.138	TRIM4_HUMAN E3 ubiquitin-protein ligase TRIM4 OS=Homo sapiens OX=9606 GN=TRIM4 PE=1 SV=2
10	A0A024RCP5	1.09e-15	77.8	518	0.277	0.125	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
11	Q9HCM9	1.09e-15	77.8	518	0.277	0.125	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
12	Q495X7	4.89e-15	75.9	471	0.272	0.136	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
13	A2AAZ5	9.80e-14	68.2	144	0.157	0.257	A2AAZ5_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=1
14	Q8IYM9	5.14e-13	69.7	498	0.260	0.122	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
15	A6NK02	1.11e-12	68.9	468	0.217	0.109	TRI75_HUMAN Tripartite motif-containing protein 75 OS=Homo sapiens OX=9606 GN=TRIM75 PE=3 SV=2
16	Q5NCC9	1.66e-12	68.6	485	0.247	0.120	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
17	Q5D7I0	5.69e-12	66.6	494	0.264	0.126	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
18	Q8BGE7	1.97e-11	65.1	488	0.294	0.141	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
19	Q9C035	2.60e-11	64.7	493	0.289	0.138	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
20	P19474	2.84e-11	64.7	475	0.268	0.133	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00111 Fer2	3.9e+02	12.4	2Fe-2S iron-sulfur cluster binding domain
2	PF14447 Prok-RING_4	1.1e+02	14.1	Prokaryotic RING finger family 4
3	PF00097 zf-C3HC4	4.1e-05	34.7	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	0.11	23.6	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.32	22.2	Zinc finger, C3HC4 type (RING finger)
6	PF15227 zf-C3HC4_4	1.9e-05	36.0	zinc finger of C3HC4-type, RING
7	PF17121 zf-C3HC4_5	1.5e+02	13.7	Zinc finger, C3HC4 type (RING finger)
8	PF11789 zf-Nse	4.1e+02	12.3	Zinc-finger of the MIZ type in Nse subunit
9	PF13639 zf-RING_2	0.79	21.5	Ring finger domain
10	PF14634 zf-RING_5	1.1e+02	14.1	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	0.072	24.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306396

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360266	0.965	Transcription factor AP-1
2	9606.ENSP00000306245	0.900	Proto-oncogene c-Fos
3	9606.ENSP00000251089	0.763	Angel homolog 1
4	9606.ENSP00000294964	0.637	Extracellular tyrosine-protein kinase PKDCC
5	9606.ENSP00000242249	0.617	Receptor activity-modifying protein 3
6	9606.ENSP00000262948	0.563	Dual specificity mitogen-activated protein kinase kinase 2
7	9606.ENSP00000382423	0.546	Mitogen-activated protein kinase kinase kinase 1
8	9606.ENSP00000376071	0.514	Protein FAM117B
9	9606.ENSP00000321330	0.503	E3 ubiquitin-protein ligase RNF144A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061630	0.335	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0048522	0.989	positive regulation of cellular process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0009987	0.980	cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0019538	0.977	protein metabolic process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0043412	0.967	macromolecule modification
GO:0051171	0.957	regulation of nitrogen compound metabolic process
GO:0036211	0.955	protein modification process
GO:0080090	0.950	regulation of primary metabolic process
GO:0016567	0.947	protein ubiquitination
GO:0010468	0.943	regulation of gene expression
GO:0044237	0.924	cellular metabolic process
GO:0000209	0.882	protein polyubiquitination
GO:0051865	0.880	protein autoubiquitination
GO:0019941	0.863	modification-dependent protein catabolic process
GO:0006511	0.847	ubiquitin-dependent protein catabolic process
GO:0019219	0.844	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.830	positive regulation of metabolic process
GO:0051252	0.824	regulation of RNA metabolic process
GO:0010604	0.811	positive regulation of macromolecule metabolic process
GO:0031325	0.810	positive regulation of cellular metabolic process
GO:0009889	0.800	regulation of biosynthetic process
GO:0051173	0.789	positive regulation of nitrogen compound metabolic process
GO:0070936	0.742	protein K48-linked ubiquitination
GO:2001141	0.702	regulation of RNA biosynthetic process
GO:0051254	0.668	positive regulation of RNA metabolic process
GO:1903506	0.617	regulation of nucleic acid-templated transcription
GO:0010498	0.616	proteasomal protein catabolic process
GO:1902680	0.585	positive regulation of RNA biosynthetic process
GO:0006355	0.504	regulation of DNA-templated transcription
GO:1903508	0.500	positive regulation of nucleic acid-templated transcription
GO:0045893	0.473	positive regulation of DNA-templated transcription
GO:0050896	0.311	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]