StarFunc result for job id Q5TA45

User Input

>input (600 residues)
MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDF
LDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANF
FTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYN
MTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVF
ALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMF
EFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVG
HKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKM
EFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLH
GTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKD
HCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q503E1	0.786	0.788	0.000	598	0.838	0.841	Q503E1.pdb.gz	INT11_DANRE Integrator complex subunit 11 OS=Danio rerio OX=7955 GN=cpsf3l PE=2 SV=1
2	AFDB:Q5TA45	1.000	1.000	0.000	600	1.000	1.000	Q5TA45.pdb.gz	INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens OX=9606 GN=INTS11 PE=1 SV=2
3	AFDB:Q9VAH9	0.783	0.787	0.000	597	0.678	0.682	Q9VAH9.pdb.gz	INT11_DROME Integrator complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=IntS11 PE=1 SV=1
4	PDB:7bfqB	0.826	0.839	5.302E-97	590	0.982	0.998	7bfqB.pdb.gz
5	PDB:7sn8K	0.815	0.832	1.964E-92	588	0.663	0.677	7sn8K.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
6	AFDB:Q8GUU3	0.760	0.744	7.322E-81	613	0.447	0.437	Q8GUU3.pdb.gz	CPS3B_ARATH Cleavage and polyadenylation specificity factor subunit 3-II OS=Arabidopsis thaliana OX=3702 GN=CPSF73-II PE=1 SV=2
7	PDB:7pksk	0.708	0.915	1.520E-80	458	0.758	0.993	7pksk.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
8	AFDB:P79101	0.731	0.644	1.481E-64	684	0.332	0.291	P79101.pdb.gz	CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus OX=9913 GN=CPSF3 PE=1 SV=1
9	AFDB:Q9VE51	0.736	0.648	5.636E-64	684	0.332	0.291	Q9VE51.pdb.gz	CPSF3_DROME Cleavage and polyadenylation specificity factor 73 OS=Drosophila melanogaster OX=7227 GN=Cpsf73 PE=1 SV=2
10	AFDB:Q96HV7	0.435	0.668	7.111E-64	389	0.647	0.997	Q96HV7.pdb.gz	Q96HV7_HUMAN CPSF3L protein OS=Homo sapiens OX=9606 GN=CPSF3L PE=1 SV=1
11	AFDB:O13794	0.740	0.591	8.972E-64	757	0.303	0.240	O13794.pdb.gz	YSH1_SCHPO Endoribonuclease ysh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ysh1 PE=3 SV=2
12	AFDB:Q581U7	0.746	0.586	1.348E-63	770	0.322	0.251	Q581U7.pdb.gz	Q581U7_TRYB2 Cleavage and polyadenylation specificity factor subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.510 PE=4 SV=1
13	AFDB:Q9C952	0.737	0.642	3.415E-63	693	0.325	0.281	Q9C952.pdb.gz	CPSF3_ARATH Cleavage and polyadenylation specificity factor subunit 3-I OS=Arabidopsis thaliana OX=3702 GN=CPSF73-I PE=1 SV=1
14	PDB:6v4xH	0.711	0.846	1.008E-54	499	0.310	0.373	6v4xH.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
15	PDB:2ycbB	0.701	0.663	4.966E-45	635	0.238	0.225	2ycbB.pdb.gz	Structure and Activity of a Novel Archaeal Beta-Casp Protein with N-Terminal Kh Domains.
16	PDB:6v4xI	0.697	0.813	1.124E-36	510	0.222	0.261	6v4xI.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
17	PDB:7sn8I	0.605	0.576	1.373E-27	634	0.187	0.177	7sn8I.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
18	PDB:7bfqA	0.549	0.546	6.137E-25	603	0.182	0.181	7bfqA.pdb.gz
19	PDB:3t3oA	0.527	0.567	3.942E-24	553	0.162	0.175	3t3oA.pdb.gz	Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
20	PDB:3zq4A	0.504	0.544	1.347E-20	550	0.127	0.138	3zq4A.pdb.gz	Unusual, Dual Endo- and Exonuclease Activity in the Degradosome Explained by Crystal Structure Analysis of Rnase J1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYI0	0.0	946	502	0.760	0.908	A0A087WYI0_HUMAN Integrator complex subunit 11 OS=Homo sapiens OX=9606 GN=INTS11 PE=1 SV=1
2	C9IYS7	0.0	947	502	0.762	0.910	C9IYS7_HUMAN Cleavage and polyadenylation specific factor 3-like, isoform CRA_i OS=Homo sapiens OX=9606 GN=INTS11 PE=1 SV=1
3	J3QRY6	0.0	708	342	0.570	1.000	J3QRY6_HUMAN Cleavage and polyadenylation specific factor 3-like, isoform CRA_g OS=Homo sapiens OX=9606 GN=INTS11 PE=1 SV=1
4	Q503E1	0.0	1085	598	0.838	0.841	INT11_DANRE Integrator complex subunit 11 OS=Danio rerio OX=7955 GN=cpsf3l PE=2 SV=1
5	Q5TA45	0.0	1255	600	1.000	1.000	INT11_HUMAN Integrator complex subunit 11 OS=Homo sapiens OX=9606 GN=INTS11 PE=1 SV=2
6	Q8GUU3	0.0	555	613	0.418	0.409	CPS3B_ARATH Cleavage and polyadenylation specificity factor subunit 3-II OS=Arabidopsis thaliana OX=3702 GN=CPSF73-II PE=1 SV=2
7	Q9VAH9	0.0	870	597	0.678	0.682	INT11_DROME Integrator complex subunit 11 OS=Drosophila melanogaster OX=7227 GN=IntS11 PE=1 SV=1
8	P79101	5.83e-110	346	684	0.303	0.266	CPSF3_BOVIN Cleavage and polyadenylation specificity factor subunit 3 OS=Bos taurus OX=9913 GN=CPSF3 PE=1 SV=1
9	Q9UKF6	6.69e-110	346	684	0.303	0.266	CPSF3_HUMAN Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1
10	Q9QXK7	1.43e-109	345	684	0.303	0.266	CPSF3_MOUSE Cleavage and polyadenylation specificity factor subunit 3 OS=Mus musculus OX=10090 GN=Cpsf3 PE=1 SV=2
11	Q9C952	1.30e-108	343	693	0.302	0.261	CPSF3_ARATH Cleavage and polyadenylation specificity factor subunit 3-I OS=Arabidopsis thaliana OX=3702 GN=CPSF73-I PE=1 SV=1
12	Q96HV7	2.16e-107	330	389	0.257	0.396	Q96HV7_HUMAN CPSF3L protein OS=Homo sapiens OX=9606 GN=CPSF3L PE=1 SV=1
13	Q9VE51	2.68e-106	337	684	0.305	0.268	CPSF3_DROME Cleavage and polyadenylation specificity factor 73 OS=Drosophila melanogaster OX=7227 GN=Cpsf73 PE=1 SV=2
14	Q581U7	3.64e-99	320	770	0.298	0.232	Q581U7_TRYB2 Cleavage and polyadenylation specificity factor subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.510 PE=4 SV=1
15	O13794	4.12e-97	315	757	0.285	0.226	YSH1_SCHPO Endoribonuclease ysh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ysh1 PE=3 SV=2
16	Q06224	5.95e-85	283	779	0.262	0.202	YSH1_YEAST Endoribonuclease YSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSH1 PE=1 SV=1
17	O27271	2.85e-65	227	636	0.245	0.231	O27271_METTH Cleavage and polyadenylation specificity factor OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=MTH_1203 PE=1 SV=1
18	Q9LKF9	1.69e-47	179	739	0.190	0.154	CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CPSF100 PE=1 SV=2
19	Q9V3D6	2.44e-41	162	756	0.188	0.149	CPSF2_DROME Probable cleavage and polyadenylation specificity factor subunit 2 OS=Drosophila melanogaster OX=7227 GN=Cpsf100 PE=1 SV=1
20	F1SD85	7.49e-31	130	777	0.173	0.134	F1SD85_PIG Cleavage and polyadenylation specificity factor subunit 2 OS=Sus scrofa OX=9823 GN=CPSF2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10996 Beta-Casp	2.4e-22	90.7	Beta-Casp domain
2	PF17030 Beta_lactamase3	2.3	18.9	Putative beta-lactamase-like family
3	PF00753 Lactamase_B	9.7e-08	43.8	Metallo-beta-lactamase superfamily
4	PF12706 Lactamase_B_2	0.00037	31.6	Beta-lactamase superfamily domain
5	PF13483 Lactamase_B_3	0.16	23.4	Beta-lactamase superfamily domain
6	PF16661 Lactamase_B_6	2.6e-18	77.7	Metallo-beta-lactamase superfamily domain
7	PF07521 RMMBL	5.9e-13	60.0	Zn-dependent metallo-hydrolase RNA specificity domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003809533.2

Rank	PPI partner	STRING score	Description
1	9597.XP_003814233.1	0.990	Integrator complex subunit 7 isoform X1
2	9597.XP_003830823.1	0.981	Integrator complex subunit 9
3	9597.XP_003819773.1	0.973	Integrator complex subunit 1
4	9597.XP_008965400.1	0.969	Integrator complex subunit 2
5	9597.XP_003805202.1	0.967	Integrator complex subunit 4
6	9597.XP_008958511.1	0.967	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
7	9597.XP_003828539.1	0.965	Integrator complex subunit 5
8	9597.XP_003809844.1	0.962	Integrator complex subunit 6
9	9597.XP_003832826.1	0.949	Cleavage and polyadenylation specificity factor subunit 2
10	9597.XP_003821719.1	0.942	Integrator complex subunit 8 isoform X1
11	9597.XP_008952746.1	0.910	DNA-directed RNA polymerase II subunit RPB2
12	9597.XP_008968588.1	0.901	Integrator complex subunit 3
13	9597.XP_008975533.1	0.900	Integrator complex subunit 10 isoform X1
14	9597.XP_003828029.1	0.899	Integrator complex subunit 14
15	9597.XP_003830027.1	0.899	Integrator complex subunit 12
16	9597.XP_003828902.1	0.892	Integrator complex subunit 13
17	9597.XP_008970985.1	0.874	Cleavage and polyadenylation specific factor 1
18	9597.XP_008960695.1	0.811	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
19	9597.XP_008952296.1	0.809	Factor interacting with PAPOLA and CPSF1
20	9597.XP_003804234.1	0.803	Sarcoma antigen 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004521	0.999	RNA endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0010467	0.992	gene expression
GO:0016073	0.987	snRNA metabolic process
GO:0006396	0.977	RNA processing
GO:0034470	0.968	ncRNA processing
GO:0016180	0.910	snRNA processing
GO:0050789	0.598	regulation of biological process
GO:0050794	0.575	regulation of cellular process
GO:0019222	0.348	regulation of metabolic process
GO:0060255	0.334	regulation of macromolecule metabolic process
GO:0080090	0.328	regulation of primary metabolic process
GO:0051171	0.326	regulation of nitrogen compound metabolic process
GO:0031323	0.326	regulation of cellular metabolic process
GO:0019219	0.300	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.983	protein-containing complex
GO:0140513	0.902	nuclear protein-containing complex
GO:0005576	0.458	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]