StarFunc result for job id Q5TA50

User Input

>input (214 residues)
MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSK
LRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQL
FLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPP
EQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TA50	1.000	1.000	9.237E-32	214	1.000	1.000	Q5TA50.pdb.gz	CPTP_HUMAN Ceramide-1-phosphate transfer protein OS=Homo sapiens OX=9606 GN=CPTP PE=1 SV=1
2	PDB:4k80A	0.950	0.972	2.782E-28	209	0.977	1.000	4k80A.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
3	AFDB:Q8BS40	0.969	0.960	8.148E-26	216	0.790	0.782	Q8BS40.pdb.gz	CPTP_MOUSE Ceramide-1-phosphate transfer protein OS=Mus musculus OX=10090 GN=Cptp PE=1 SV=1
4	PDB:4kbrB	0.939	0.970	1.727E-24	207	0.752	0.778	4kbrB.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
5	AFDB:O64587	0.806	0.835	7.702E-9	206	0.224	0.233	O64587.pdb.gz	ACD11_ARATH Accelerated cell death 11 OS=Arabidopsis thaliana OX=3702 GN=ACD11 PE=1 SV=1
6	AFDB:A0A2P1JJM6	0.822	0.352	2.281E-8	519	0.229	0.094	A0A2P1JJM6.pdb.gz	A0A2P1JJM6_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens OX=9606 GN=PLEKHA8 PE=2 SV=1
7	AFDB:Q8L7U7	0.786	0.738	3.028E-8	229	0.187	0.175	Q8L7U7.pdb.gz	ACDH_ARATH ACD11 homolog protein OS=Arabidopsis thaliana OX=3702 GN=At4g39670 PE=2 SV=1
8	PDB:4gxgA	0.758	0.774	9.712E-8	209	0.173	0.177	4gxgA.pdb.gz	Structural insights into lipid-dependent reversible dimerization of human GLTP.
9	PDB:4ntiA	0.786	0.830	1.351E-7	202	0.192	0.203	4ntiA.pdb.gz	Arabidopsis Accelerated Cell Death 11, ACD11, Is a Ceramide-1-Phosphate Transfer Protein and Intermediary Regulator of Phytoceramide Levels.
10	AFDB:A0A024RBI7	0.777	0.794	1.580E-7	209	0.168	0.172	A0A024RBI7.pdb.gz
11	AFDB:A0A1D8PPA5	0.773	0.835	3.875E-7	197	0.145	0.157	A0A1D8PPA5.pdb.gz	A0A1D8PPA5_CANAL Het1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HET1 PE=4 SV=1
12	AFDB:O22797	0.794	0.837	4.465E-7	202	0.182	0.193	O22797.pdb.gz	GLTP1_ARATH Glycolipid transfer protein 1 OS=Arabidopsis thaliana OX=3702 GN=GLTP1 PE=2 SV=1
13	AFDB:P9WI61	0.321	0.130	1.851E-1	789	0.173	0.047	P9WI61.pdb.gz	PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB PE=1 SV=1
14	AFDB:D6RCM8	0.170	0.178	1.940E-1	200	0.126	0.135	D6RCM8.pdb.gz	D6RCM8_HUMAN TNF alpha induced protein 8 OS=Homo sapiens OX=9606 GN=TNFAIP8 PE=1 SV=1
15	PDB:2bb5A	0.177	0.125	2.101E-1	409	0.206	0.108	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
16	PDB:3rm5A	0.278	0.143	2.923E-1	521	0.131	0.054	3rm5A.pdb.gz
17	PDB:5jxdA	0.145	0.165	3.702E-1	186	0.103	0.118	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
18	PDB:7mezB	0.154	0.079	4.265E-1	547	0.145	0.057	7mezB.pdb.gz
19	PDB:2jcdA	0.178	0.136	4.471E-1	315	0.131	0.089	2jcdA.pdb.gz	Structure and Action of the N-Oxygenase Aurf from Streptomyces Thioluteus.
20	PDB:1bp3A	0.179	0.196	8.658E-1	186	0.093	0.108	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TA50	7.43e-160	442	214	1.000	1.000	CPTP_HUMAN Ceramide-1-phosphate transfer protein OS=Homo sapiens OX=9606 GN=CPTP PE=1 SV=1
2	S4S694	7.43e-160	442	214	1.000	1.000	S4S694_HUMAN Ceramide-1-phosphate transfer protein OS=Homo sapiens OX=9606 GN=GLTPD1 PE=2 SV=1
3	Q8BS40	2.72e-126	357	216	0.790	0.782	CPTP_MOUSE Ceramide-1-phosphate transfer protein OS=Mus musculus OX=10090 GN=Cptp PE=1 SV=1
4	J3KST3	8.43e-83	243	117	0.547	1.000	J3KST3_HUMAN Ceramide-1-phosphate transfer protein (Fragment) OS=Homo sapiens OX=9606 GN=CPTP PE=1 SV=8
5	D2KC46	1.53e-09	59.3	519	0.220	0.091	PKHA8_CANLF Pleckstrin homology domain-containing family A member 8 OS=Canis lupus familiaris OX=9615 GN=PLEKHA8 PE=1 SV=2
6	A0A2P1JJM6	4.78e-09	57.8	519	0.220	0.091	A0A2P1JJM6_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens OX=9606 GN=PLEKHA8 PE=2 SV=1
7	Q96JA3	4.78e-09	57.8	519	0.220	0.091	PKHA8_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens OX=9606 GN=PLEKHA8 PE=1 SV=3
8	O64587	2.33e-06	48.9	206	0.224	0.233	ACD11_ARATH Accelerated cell death 11 OS=Arabidopsis thaliana OX=3702 GN=ACD11 PE=1 SV=1
9	Q8L7U7	6.56e-06	47.8	229	0.210	0.197	ACDH_ARATH ACD11 homolog protein OS=Arabidopsis thaliana OX=3702 GN=At4g39670 PE=2 SV=1
10	A0A087X1S6	7.98e-06	48.1	459	0.154	0.072	A0A087X1S6_HUMAN Pleckstrin homology domain-containing family A member 8 OS=Homo sapiens OX=9606 GN=PLEKHA8 PE=1 SV=1
11	O22797	1.35e-05	46.6	202	0.168	0.178	GLTP1_ARATH Glycolipid transfer protein 1 OS=Arabidopsis thaliana OX=3702 GN=GLTP1 PE=2 SV=1
12	Q9NZD2	5.07e-05	45.1	209	0.173	0.177	GLTP_HUMAN Glycolipid transfer protein OS=Homo sapiens OX=9606 GN=GLTP PE=1 SV=3
13	F5H0U5	0.032	36.6	190	0.150	0.168	F5H0U5_HUMAN Glycolipid transfer protein OS=Homo sapiens OX=9606 GN=GLTP PE=1 SV=1
14	A0A1D8PPA5	1.2	32.0	197	0.164	0.178	A0A1D8PPA5_CANAL Het1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HET1 PE=4 SV=1
15	Q57UM7	2.4	31.2	290	0.107	0.079	Q57UM7_TRYB2 DH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.780 PE=4 SV=1
16	Q5THJ4	3.0	31.6	4388	0.061	0.003	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
17	A0A669KB12	6.4	30.4	2388	0.065	0.006	A0A669KB12_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=1
18	B2RWS6	6.4	30.4	2412	0.065	0.006	EP300_MOUSE Histone acetyltransferase p300 OS=Mus musculus OX=10090 GN=Ep300 PE=1 SV=2
19	Q09472	6.4	30.4	2414	0.065	0.006	EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2
20	Q8T0R7	7.0	30.0	444	0.107	0.052	IDGF5_DROME Chitinase-like protein Idgf5 OS=Drosophila melanogaster OX=7227 GN=Idgf5 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08718 GLTP	4.8e-38	142.1	Glycolipid transfer protein (GLTP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315263	0.779	Glycolipid transfer protein
2	9606.ENSP00000368169	0.702	Segment polarity protein dishevelled homolog DVL-1
3	9606.ENSP00000216264	0.687	Ceramide kinase
4	9606.ENSP00000366934	0.682	Polynucleotide 5'-hydroxyl-kinase NOL9
5	9606.ENSP00000366902	0.681	Telomere zinc finger-associated protein
6	9606.ENSP00000364490	0.654	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
7	9606.ENSP00000369862	0.558	Collagen type IV alpha-3-binding protein
8	9606.ENSP00000386959	0.512	Calcyphosin-2
9	9606.ENSP00000344411	0.511	Taste receptor type 1 member 3
10	9606.ENSP00000378897	0.503	Neutral ceramidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043168	1.000	anion binding
GO:0005543	1.000	phospholipid binding
GO:0120016	1.000	sphingolipid transfer activity
GO:0120014	1.000	phospholipid transfer activity
GO:0097001	1.000	ceramide binding
GO:1902387	0.987	ceramide 1-phosphate binding
GO:1902388	0.985	ceramide 1-phosphate transfer activity
GO:0005515	0.566	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0050789	0.996	regulation of biological process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006643	0.990	membrane lipid metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0051239	0.979	regulation of multicellular organismal process
GO:0009892	0.979	negative regulation of metabolic process
GO:0006665	0.974	sphingolipid metabolic process
GO:0051241	0.971	negative regulation of multicellular organismal process
GO:0051179	0.970	localization
GO:0001818	0.959	negative regulation of cytokine production
GO:0032651	0.957	regulation of interleukin-1 beta production
GO:0010876	0.935	lipid localization
GO:0032692	0.932	negative regulation of interleukin-1 production
GO:0050794	0.922	regulation of cellular process
GO:1903509	0.913	liposaccharide metabolic process
GO:0006664	0.864	glycolipid metabolic process
GO:0006810	0.832	transport
GO:0071702	0.806	organic substance transport
GO:0006869	0.794	lipid transport
GO:0048523	0.771	negative regulation of cellular process
GO:0031323	0.753	regulation of cellular metabolic process
GO:0006687	0.541	glycosphingolipid metabolic process
GO:0015748	0.480	organophosphate ester transport
GO:0071840	0.465	cellular component organization or biogenesis
GO:0009894	0.459	regulation of catabolic process
GO:0031329	0.452	regulation of cellular catabolic process
GO:0016043	0.445	cellular component organization
GO:0031324	0.379	negative regulation of cellular metabolic process
GO:0071705	0.375	nitrogen compound transport
GO:0010506	0.346	regulation of autophagy
GO:0009895	0.322	negative regulation of catabolic process
GO:0044087	0.321	regulation of cellular component biogenesis
GO:0031330	0.309	negative regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.445	intracellular membrane-bounded organelle
GO:0016020	0.414	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]