StarFunc result for job id Q5TA89

User Input

>input (166 residues)
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70120	0.789	0.785	7.914E-22	167	0.922	0.916	P70120.pdb.gz	HES5_MOUSE Transcription factor HES-5 OS=Mus musculus OX=10090 GN=Hes5 PE=1 SV=1
2	AFDB:Q4QRL6	0.436	0.465	1.356E-8	155	0.428	0.458	Q4QRL6.pdb.gz
3	AFDB:B0V3D1	0.379	0.412	2.601E-8	152	0.373	0.408	B0V3D1.pdb.gz	B0V3D1_DANRE Hairy-related 4, tandem duplicate 2 OS=Danio rerio OX=7955 GN=Hes5d PE=4 SV=1
4	AFDB:Q7T3J0	0.453	0.495	2.230E-7	149	0.428	0.477	Q7T3J0.pdb.gz	Q7T3J0_DANRE Hairy and enhancer of split 5 OS=Danio rerio OX=7955 GN=hes5 PE=2 SV=1
5	AFDB:Q9HCC6	0.384	0.299	3.355E-5	221	0.428	0.321	Q9HCC6.pdb.gz	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
6	AFDB:Q9Y543	0.405	0.391	3.355E-5	173	0.331	0.318	Q9Y543.pdb.gz	HES2_HUMAN Transcription factor HES-2 OS=Homo sapiens OX=9606 GN=HES2 PE=2 SV=1
7	AFDB:Q8UW72	0.396	0.375	3.821E-5	180	0.271	0.250	Q8UW72.pdb.gz	HE71B_XENLA Transcription factor HES-7.1-B OS=Xenopus laevis OX=8355 GN=hes7.1-b PE=2 SV=1
8	AFDB:A3KQ57	0.397	0.326	5.648E-5	206	0.349	0.282	A3KQ57.pdb.gz
9	AFDB:Q568C3	0.404	0.276	6.866E-5	253	0.277	0.182	Q568C3.pdb.gz
10	AFDB:Q90464	0.335	0.508	1.083E-4	108	0.265	0.407	Q90464.pdb.gz	Q90464_DANRE HER-2 protein OS=Danio rerio OX=7955 GN=HER-2 PE=2 SV=1
11	PDB:4h9sA	0.165	0.263	1.648	89	0.084	0.157	4h9sA.pdb.gz
12	PDB:5nbdA	0.177	0.066	2.003	564	0.157	0.046	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
13	PDB:7abgA4	0.183	0.097	2.003	405	0.163	0.067	7abgA4.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	PDB:7xayD	0.171	0.281	2.003	97	0.066	0.113	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
15	PDB:6byrA	0.152	0.084	3.599	405	0.072	0.030	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
16	PDB:7k041	0.161	0.065	4.984	487	0.120	0.041	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
17	PDB:4v6wCC	0.165	0.078	5.319	392	0.054	0.023	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:7cgpJ	0.161	0.289	6.059	83	0.090	0.181	7cgpJ.pdb.gz
19	PDB:3c98B	0.205	0.155	6.467	230	0.108	0.078	3c98B.pdb.gz
20	PDB:3vh5A	0.139	0.191	6.902	100	0.072	0.120	3vh5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TA89	4.55e-119	335	166	1.000	1.000	HES5_HUMAN Transcription factor HES-5 OS=Homo sapiens OX=9606 GN=HES5 PE=2 SV=1
2	Q03062	2.47e-103	295	166	0.892	0.892	HES5_RAT Transcription factor HES-5 OS=Rattus norvegicus OX=10116 GN=Hes5 PE=2 SV=1
3	P70120	2.92e-88	257	167	0.819	0.814	HES5_MOUSE Transcription factor HES-5 OS=Mus musculus OX=10090 GN=Hes5 PE=1 SV=1
4	Q6TA36	7.24e-34	119	155	0.422	0.452	Q6TA36_DANRE BHLH transcription factor OS=Danio rerio OX=7955 GN=her12 PE=2 SV=1
5	B0V3D3	1.20e-30	110	152	0.398	0.434	B0V3D3_DANRE Hairy-related 4, tandem duplicate 4 OS=Danio rerio OX=7955 GN=si:ch73-21g5.5 PE=4 SV=1
6	Q7T3J0	5.84e-30	108	149	0.416	0.463	Q7T3J0_DANRE Hairy and enhancer of split 5 OS=Danio rerio OX=7955 GN=hes5 PE=2 SV=1
7	B0V3D4	8.14e-30	108	152	0.422	0.461	B0V3D4_DANRE Hairy-related 4, tandem duplicate 2 OS=Danio rerio OX=7955 GN=her4.5 PE=4 SV=1
8	B0V3D1	1.03e-29	108	152	0.422	0.461	B0V3D1_DANRE Hairy-related 4, tandem duplicate 2 OS=Danio rerio OX=7955 GN=Hes5d PE=4 SV=1
9	Q90466	1.28e-29	107	152	0.392	0.428	Q90466_DANRE HER-4 protein OS=Danio rerio OX=7955 GN=Hes5e PE=2 SV=1
10	B0V3D2	3.92e-29	106	152	0.386	0.421	B0V3D2_DANRE Hairy-related 4, tandem duplicate 3 OS=Danio rerio OX=7955 GN=her4.1 PE=4 SV=1
11	Q90464	7.45e-23	89.4	108	0.331	0.509	Q90464_DANRE HER-2 protein OS=Danio rerio OX=7955 GN=HER-2 PE=2 SV=1
12	F1QI81	1.46e-15	73.2	221	0.265	0.199	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
13	Q6XLQ0	2.07e-15	73.6	290	0.283	0.162	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
14	O57337	3.69e-15	73.2	290	0.283	0.162	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
15	Q6IRB2	6.68e-15	72.0	267	0.265	0.165	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
16	Q04666	7.22e-15	72.0	281	0.265	0.157	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1
17	Q14469	7.91e-15	72.0	280	0.265	0.157	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
18	P35428	1.15e-14	71.6	282	0.265	0.156	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
19	Q6PBX3	1.23e-14	71.2	270	0.283	0.174	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
20	Q9DF41	2.25e-14	70.9	291	0.253	0.144	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14631 FancD2	65	12.4	Fanconi anaemia protein FancD2 nuclease
2	PF07527 Hairy_orange	6e-05	34.5	Hairy Orange
3	PF00010 HLH	5.5e-13	60.0	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367714

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.985	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000345206	0.978	Recombining binding protein suppressor of hairless
3	9606.ENSP00000256646	0.971	Neurogenic locus notch homolog protein 2
4	9606.ENSP00000263388	0.969	Neurogenic locus notch homolog protein 3
5	9606.ENSP00000364163	0.961	Neurogenic locus notch homolog protein 4
6	9606.ENSP00000292599	0.953	Mastermind-like protein 1
7	9606.ENSP00000434552	0.930	Mastermind-like protein 2
8	9606.ENSP00000421180	0.922	Mastermind-like protein 3
9	9606.ENSP00000263253	0.918	Histone acetyltransferase p300
10	9606.ENSP00000261531	0.915	SNW domain-containing protein 1
11	9606.ENSP00000225916	0.907	Histone acetyltransferase KAT2A
12	9606.ENSP00000262367	0.907	CREB-binding protein
13	9606.ENSP00000263754	0.907	Histone acetyltransferase KAT2B
14	9606.ENSP00000414517	0.906	Mastermind-like domain-containing protein 1
15	9606.ENSP00000264657	0.868	Signal transducer and activator of transcription 3
16	9606.ENSP00000232424	0.840	Transcription factor HES-1
17	9606.ENSP00000355718	0.778	Delta-like protein 1
18	9606.ENSP00000266744	0.763	Achaete-scute homolog 1
19	9606.ENSP00000254958	0.760	Protein jagged-1
20	9606.ENSP00000205143	0.744	Delta-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0001217	0.994	DNA-binding transcription repressor activity
GO:0001227	0.980	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048856	0.988	anatomical structure development
GO:0032501	0.987	multicellular organismal process
GO:0048519	0.987	negative regulation of biological process
GO:0009987	0.984	cellular process
GO:0007275	0.966	multicellular organism development
GO:0048523	0.965	negative regulation of cellular process
GO:0048731	0.957	system development
GO:0050793	0.952	regulation of developmental process
GO:0050896	0.944	response to stimulus
GO:0045892	0.942	negative regulation of DNA-templated transcription
GO:0019827	0.939	stem cell population maintenance
GO:0045595	0.937	regulation of cell differentiation
GO:0097150	0.930	neuronal stem cell population maintenance
GO:0051093	0.917	negative regulation of developmental process
GO:0045596	0.902	negative regulation of cell differentiation
GO:0048513	0.901	animal organ development
GO:0006357	0.882	regulation of transcription by RNA polymerase II
GO:0009888	0.875	tissue development
GO:0007399	0.870	nervous system development
GO:0048518	0.859	positive regulation of biological process
GO:0007219	0.858	Notch signaling pathway
GO:0048522	0.821	positive regulation of cellular process
GO:0030154	0.808	cell differentiation
GO:0042127	0.713	regulation of cell population proliferation
GO:2000736	0.700	regulation of stem cell differentiation
GO:0001501	0.633	skeletal system development
GO:0009893	0.632	positive regulation of metabolic process
GO:0009653	0.629	anatomical structure morphogenesis
GO:0010604	0.624	positive regulation of macromolecule metabolic process
GO:0007417	0.623	central nervous system development
GO:0045664	0.553	regulation of neuron differentiation
GO:0042063	0.526	gliogenesis
GO:0051173	0.521	positive regulation of nitrogen compound metabolic process
GO:0045665	0.516	negative regulation of neuron differentiation
GO:0031325	0.477	positive regulation of cellular metabolic process
GO:0061448	0.458	connective tissue development
GO:0000122	0.445	negative regulation of transcription by RNA polymerase II
GO:0010557	0.419	positive regulation of macromolecule biosynthetic process
GO:0051216	0.397	cartilage development
GO:0045893	0.355	positive regulation of DNA-templated transcription
GO:0045944	0.343	positive regulation of transcription by RNA polymerase II
GO:0008284	0.310	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]