StarFunc result for job id Q5TAG4

User Input

>input (1457 residues)
MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFRNLKERCFLTQLAGFLANRQKKYKY
EECKDLIKFMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDAS
RSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQQLVQKLSPENDEDEDEDVQVEEDE
KVLESSAPREVQKAEESKVPEDSLEECAITCSNSHGPCDSIQPHKNIKITFEEDKVNSTV
VVDRKSSHDECQDALNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLRPQLA
EKKQQFRSLKEKCFVTQLAGFLAKQQNKYKYEECKDLIKSMLRNELQFKEEKLAEQLKQA
EELRQYKVLVHSQERELTQLREKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLA
EGCRLAQHLVQKLSPENDEDEDEDVQVEEDEKVLESSSPREMQKAEESKVPEDSLEECAI
TCSNSHGPCDSNQPHKNIKITFEEDKVNSSLVVDRESSHDECQDALNILPVPGPTSSATN
VSMVVSAGPLSSEKAEMNILEINEKLRPQLAEKKQQFRSLKEKCFVTQVACFLAKQQNKY
KYEECKDLLKSMLRNELQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRD
ASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDNDDDEDVQVEV
AEKVQKSSSPREMQKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDS
TLIGSSSHVEWEDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLS
IPPERLASYQSYSSTFHSLEEQQVCMAVDIGRHRWDQVKKEDQEATGPRLSRELLAEKEP
EVLQDSLDRCYSTPSVYLGLTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEEDQDP
SCPRLSRELLAEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGLALDV
DRIKKDQEEEEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQPYRSS
FYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKKRRRGRKEGEEDQNPPCPRLSRELLA
EKEPEVLQDSLDRWYSTPSVYLGLTDPCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEE
DQDPSCPRLSRELLAEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGL
ALDVDRIKKDQEEEEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQP
YRSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKKRRRGRKEGEEDQNPPCPRLNS
VLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYRSVFYSFEEQHITFALDMDNSFFTL
TVTSLHLVFQMGVIFPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DPF3	0.206	0.268	0.000	1111	0.732	0.960	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
2	AFDB:Q3BBV0	0.261	0.306	0.000	1214	0.763	0.915	Q3BBV0.pdb.gz	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
3	AFDB:Q6P3W6	0.201	0.330	5.576E-87	841	0.547	0.948	Q6P3W6.pdb.gz	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
4	AFDB:A0A2K7P776	0.176	0.288	3.968E-83	867	0.539	0.905	A0A2K7P776.pdb.gz	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
5	AFDB:Q9UFD9	0.065	0.059	1.841E-7	1639	0.167	0.149	Q9UFD9.pdb.gz	RIM3A_HUMAN RIMS-binding protein 3A OS=Homo sapiens OX=9606 GN=RIMBP3 PE=1 SV=4
6	AFDB:Q57ZN6	0.055	0.045	7.026E-6	1558	0.136	0.127	Q57ZN6.pdb.gz	Q57ZN6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.80 PE=4 SV=1
7	AFDB:Q1G7G9	0.050	0.048	8.380E-6	1523	0.141	0.135	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
8	AFDB:Q38BU4	0.055	0.061	1.508E-5	1223	0.115	0.137	Q38BU4.pdb.gz	Q38BU4_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4540 PE=4 SV=1
9	AFDB:P34216	0.066	0.069	9.879E-5	1381	0.102	0.108	P34216.pdb.gz	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2
10	AFDB:Q5YL88	0.042	0.050	1.048E-4	1205	0.118	0.143	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
11	PDB:7rroD1	0.055	0.152	1.413E-1	425	0.020	0.068	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:2p22C	0.041	0.247	3.217E-1	186	0.019	0.151	2p22C.pdb.gz
13	PDB:7ungD2	0.057	0.171	6.510E-1	398	0.016	0.058	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7rroA1	0.054	0.159	6.904E-1	396	0.014	0.051	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:6k1zA	0.054	0.122	7.322E-1	544	0.015	0.040	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
16	PDB:7ungB0	0.038	0.174	1.042	193	0.016	0.124	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:7rroF1	0.054	0.147	1.105	421	0.012	0.040	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:3euhB	0.035	0.128	1.397	321	0.016	0.072	3euhB.pdb.gz
19	PDB:7rroB1	0.040	0.108	1.397	416	0.017	0.060	7rroB1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:1ek8A	0.035	0.191	1.666	185	0.010	0.081	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUL8	0.0	1373	3843	0.566	0.214	NBPFJ_HUMAN Neuroblastoma breakpoint family member 19 OS=Homo sapiens OX=9606 GN=NBPF19 PE=5 SV=1
2	A0A2K7P776	0.0	1330	867	0.502	0.843	A0A2K7P776_HUMAN NBPF9 isoform 1 OS=Homo sapiens OX=9606 PE=1 SV=1
3	P0DPF2	0.0	627	5207	0.259	0.072	NBPFK_HUMAN Neuroblastoma breakpoint family member 20 OS=Homo sapiens OX=9606 GN=NBPF20 PE=3 SV=1
4	P0DPF3	0.0	1691	1111	0.657	0.861	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
5	Q3BBV0	0.0	2029	1214	0.756	0.908	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
6	Q5TI25	0.0	1250	921	0.489	0.774	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
7	Q6P3W6	0.0	1880	3795	0.743	0.285	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
8	Q5VU43	6.51e-10	66.6	2346	0.040	0.025	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
9	B7ZNY0	3.76e-09	64.3	2412	0.041	0.025	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
10	Q80YT7	9.02e-09	63.2	2224	0.038	0.025	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
11	M9PI41	0.043	41.2	1858	0.032	0.025	M9PI41_DROME Sticky, isoform B OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=1
12	Q9VTY8	0.044	40.8	1854	0.032	0.025	Q9VTY8_DROME FI02033p OS=Drosophila melanogaster OX=7227 GN=sti PE=1 SV=2
13	Q9WUJ3	0.23	38.5	2324	0.021	0.013	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14617 CMS1	8.5	17.2	U3-containing 90S pre-ribosomal complex subunit
2	PF06869 DUF1258	61	14.6	Protein of unknown function (DUF1258)
3	PF03127 GAT	0.024	26.2	GAT domain
4	PF06758 Olduvai	9.9e-257	841.0	Olduvai domain
5	PF00024 PAN_1	6.6e+02	11.7	PAN domain
6	PF07521 RMMBL	9.1	17.7	Zn-dependent metallo-hydrolase RNA specificity domain
7	PF18335 SH3_13	32	15.7	ATP-dependent RecD-like DNA helicase SH3 domain
8	PF06122 TraH	2e+02	12.7	Conjugative relaxosome accessory transposon protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478609

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478962	0.831	Protein chibby homolog 1
2	9606.ENSP00000320324	0.814	Puromycin-sensitive aminopeptidase
3	9606.ENSP00000320401	0.814	UDP-glucuronosyltransferase 2B17
4	9606.ENSP00000377197	0.814	Hydrocephalus-inducing protein homolog
5	9606.ENSP00000363436	0.812	G protein-regulated inducer of neurite outgrowth 2
6	9606.ENSP00000393845	0.812	Peptidyl-prolyl cis-trans isomerase A-like 4G
7	9606.ENSP00000463057	0.812	Peptidyl-prolyl cis-trans isomerase A-like 4C
8	9606.ENSP00000463419	0.812	Peptidylprolyl isomerase A like 4F
9	9606.ENSP00000464619	0.812	Peptidyl-prolyl cis-trans isomerase
10	9606.ENSP00000485206	0.812	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity)
11	9606.ENSP00000485638	0.812	annotation not available
12	9606.ENSP00000459615	0.772	SLIT-ROBO Rho GTPase-activating protein 2
13	9606.ENSP00000373347	0.768	SLIT-ROBO Rho GTPase-activating protein 3
14	9606.ENSP00000306129	0.767	D(1B) dopamine receptor
15	9606.ENSP00000460070	0.740	General transcription factor II-I
16	9606.ENSP00000485398	0.561	speedy/RINGO cell cycle regulator family member E5
17	9606.ENSP00000359356	0.517	Ecotropic viral integration site 5 protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.400	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0065007	0.975	biological regulation
GO:0050789	0.966	regulation of biological process
GO:0050794	0.882	regulation of cellular process
GO:0048518	0.347	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0005856	0.984	cytoskeleton
GO:0016020	0.964	membrane
GO:0071944	0.959	cell periphery
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0005886	0.622	plasma membrane
GO:0070013	0.577	intracellular organelle lumen
GO:0012505	0.545	endomembrane system
GO:0031981	0.466	nuclear lumen
GO:0005654	0.439	nucleoplasm
GO:0005829	0.323	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]