StarFunc result for job id Q5TAH2

User Input

>input (1124 residues)
MSSYFWAQNESNRPDLLCGQPADYLVEEKHFTTLVCFIVVLGGLLKMCLKNCEVIVLTIL
SLSGFVIGHMAYNSVEVHQIVYPLLRTSSFSLYSYFSPLIIFMVALDVEFYTLKKMFWQV
LLTGLISFSTASIIIGYVVIKFNKDSWDLQSCLLFSITLGIIDPLRSVNSLKTIGISKIY
IDLIRGESLIICSIASIFFGNFRGNRIHFSIFRDLHVGIELSYDILGSIIFGYWCAKIIQ
CILADVFSNMLTNIILCFSMVYMTFYIVEFLGMSGTLALAAVGLNLDSLTFKPKIELVIT
KFLRIFSSVYEHLIYAFFGIVIGCGELSHYEFHTIPFIFILFTTVNLVRLLTILLVSPIL
MHSNYEYNWRWGVVITWSGIKGVFNLLWAPDVYNLAERKVEVPQMFILYVQVISLLTMGI
NSYVMTQSARKLDLCVLSLPRQMILQNATQHIQEIVQNTITLFKTEKILTNVNWTLVEDK
TRIEYIPFSHVSHNDMKTESTTDEALMEEARLHVAAIQMSSFEKQRNNGILEIEAARILI
GAAKCYYSIQGKFMSIYDVSTYMRTRSWLIKFKNVLTFLEYCIEKIHFIPPESNTFLTFI
FHIVFSEEFEYTGQIINLIYIYPMIIHLWPMARGLNVSALISINYYFMFLYVLESTLKII
ILKRKYFQQCWNTLEFFILVIGIIDIFCVYFVKLRPDNLALIQLTVIMGYLRIIRFLPLF
KIIVPILIRIADVQIKKRLSLMYSITKGYIKSQEDAKLLIKQIAVCESIYQKLCEILETN
KQDAVKELVLMEHEGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHEVIEINKVL
LKKLKALNNFPKAIPPPTPDIYLHNIIWLEGKDVLIDFFKERAKLACFDSGDTICKGGEM
PQGIYLIISGMAILHSLSPTFGIESNQRCDRGSRDMFTEFCTTGDIIGELSCLLKREIEY
TVICETSLQACFISLEDLYEGFDAFWPSLEYKIWLKLALSTAYQYFESSLIDEDLRFQNC
VMFNQAYVETLSSYSDMIIDNMTMKFVIIVYGSVIDTKTEEPYFAPCIIPTTCEQVQGTS
DLSKLLIIQASELTQRNSNTNVMASVNTVFEQPGKNINGRQKMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UJY2	0.875	0.839	6.537E-65	1175	0.279	0.267	Q6UJY2.pdb.gz	SL9C1_MOUSE Sodium/hydrogen exchanger 10 OS=Mus musculus OX=10090 GN=Slc9c1 PE=1 SV=3
2	AFDB:Q9LKW9	0.595	0.585	2.305E-33	1146	0.171	0.168	Q9LKW9.pdb.gz	NHX7_ARATH Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana OX=3702 GN=NHX7 PE=1 SV=1
3	AFDB:Q3YL57	0.526	0.760	2.769E-22	756	0.133	0.198	Q3YL57.pdb.gz	NHX8_ARATH Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana OX=3702 GN=NHX8 PE=2 SV=1
4	AFDB:Q8S396	0.327	0.666	1.164E-13	521	0.070	0.152	Q8S396.pdb.gz	NHX5_ARATH Sodium/hydrogen exchanger 5 OS=Arabidopsis thaliana OX=3702 GN=NHX5 PE=2 SV=2
5	AFDB:Q8BUE1	0.317	0.437	3.318E-13	797	0.085	0.120	Q8BUE1.pdb.gz	SL9A4_MOUSE Sodium/hydrogen exchanger 4 OS=Mus musculus OX=10090 GN=Slc9a4 PE=1 SV=1
6	AFDB:Q8RWU6	0.317	0.625	8.339E-13	535	0.069	0.146	Q8RWU6.pdb.gz	NHX6_ARATH Sodium/hydrogen exchanger 6 OS=Arabidopsis thaliana OX=3702 GN=NHX6 PE=1 SV=3
7	AFDB:Q6AI14	0.319	0.439	8.696E-13	798	0.088	0.124	Q6AI14.pdb.gz	SL9A4_HUMAN Sodium/hydrogen exchanger 4 OS=Homo sapiens OX=9606 GN=SLC9A4 PE=2 SV=2
8	AFDB:B0S734	0.324	0.449	2.930E-12	795	0.093	0.131	B0S734.pdb.gz
9	AFDB:B6VDZ5	0.322	0.422	3.186E-12	842	0.075	0.100	B6VDZ5.pdb.gz	B6VDZ5_ONCMY Sodium/hydrogen exchanger OS=Oncorhynchus mykiss OX=8022 GN=NHE3b PE=2 SV=1
10	AFDB:A0A060Y126	0.307	0.423	3.768E-12	798	0.066	0.093	A0A060Y126.pdb.gz	A0A060Y126_ONCMY Sodium/hydrogen exchanger OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00042155001 PE=3 SV=1
11	PDB:5dykA	0.112	0.143	3.306E-8	809	0.027	0.037	5dykA.pdb.gz
12	PDB:4czbB	0.285	0.686	8.666E-8	419	0.073	0.196	4czbB.pdb.gz
13	PDB:6byrB	0.091	0.323	5.708E-7	288	0.028	0.111	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:7rhsA	0.097	0.223	1.435E-6	456	0.062	0.154	7rhsA.pdb.gz
15	PDB:3j4qB	0.096	0.261	2.689E-6	382	0.024	0.071	3j4qB.pdb.gz
16	PDB:4dinB	0.089	0.264	5.961E-6	345	0.026	0.084	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
17	PDB:7rhsD	0.099	0.216	6.759E-6	441	0.051	0.129	7rhsD.pdb.gz
18	PDB:7n15A	0.097	0.198	7.350E-6	520	0.043	0.092	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
19	PDB:4bwzA	0.278	0.713	9.063E-6	384	0.048	0.141	4bwzA.pdb.gz	A two-domain elevator mechanism for sodium/proton antiport.
20	PDB:4byyA	0.112	0.491	1.321E-5	226	0.028	0.137	4byyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UJY2	1.27e-147	475	1175	0.285	0.272	SL9C1_MOUSE Sodium/hydrogen exchanger 10 OS=Mus musculus OX=10090 GN=Slc9c1 PE=1 SV=3
2	Q9LKW9	1.22e-18	94.7	1146	0.106	0.104	NHX7_ARATH Sodium/hydrogen exchanger 7 OS=Arabidopsis thaliana OX=3702 GN=NHX7 PE=1 SV=1
3	Q3YL57	1.20e-14	81.3	756	0.087	0.130	NHX8_ARATH Sodium/hydrogen exchanger 8 OS=Arabidopsis thaliana OX=3702 GN=NHX8 PE=2 SV=1
4	Q7Z003	6.21e-06	53.1	1885	0.033	0.020	Q7Z003_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
5	G5EBS2	6.29e-06	53.1	1837	0.033	0.020	G5EBS2_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
6	Q7YZR6	6.29e-06	53.1	1844	0.033	0.020	Q7YZR6_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
7	Q7Z002	6.68e-06	53.1	1852	0.033	0.020	Q7Z002_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
8	M9PGH9	4.12e-04	47.4	3218	0.036	0.013	M9PGH9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform F OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
9	M9NDQ0	4.45e-04	47.0	3200	0.036	0.013	M9NDQ0_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform E OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
10	Q9W433	4.48e-04	47.0	3188	0.036	0.013	Q9W433_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform B OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=3
11	Q91ZR5	4.53e-04	47.0	686	0.026	0.042	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
12	A8JUY8	4.64e-04	47.0	3205	0.036	0.013	A8JUY8_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform C OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
13	M9NGR9	4.75e-04	47.0	3180	0.036	0.013	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
14	P15389	4.79e-04	47.0	2019	0.033	0.018	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
15	Q9Y5Y9	4.82e-04	47.0	1956	0.032	0.018	SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens OX=9606 GN=SCN10A PE=1 SV=2
16	Q9JJV9	5.08e-04	47.0	2019	0.033	0.018	SCN5A_MOUSE Sodium channel protein type 5 subunit alpha OS=Mus musculus OX=10090 GN=Scn5a PE=1 SV=2
17	O08562	5.43e-04	47.0	1984	0.033	0.019	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
18	B1AWN6	6.54e-04	46.6	2006	0.032	0.018	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
19	Q62205	6.93e-04	46.6	1984	0.033	0.019	SCN9A_MOUSE Sodium channel protein type 9 subunit alpha OS=Mus musculus OX=10090 GN=Scn9a PE=1 SV=2
20	P04775	7.12e-04	46.6	2005	0.032	0.018	SCN2A_RAT Sodium channel protein type 2 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	0.00014	33.2	Cyclic nucleotide-binding domain
2	PF00999 Na_H_Exchanger	4.6e-17	73.5	Sodium/hydrogen exchanger family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480150	0.943	Hypoxia up-regulated protein 1
2	9606.ENSP00000373620	0.823	60 kDa heat shock protein, mitochondrial
3	9606.ENSP00000357998	0.815	Translocation protein SEC63 homolog
4	9606.ENSP00000299767	0.799	Endoplasmin
5	9606.ENSP00000247461	0.766	Calnexin
6	9606.ENSP00000326699	0.766	Calmegin
7	9606.ENSP00000473631	0.765	DnaJ homolog subfamily C member 3
8	9606.ENSP00000264065	0.735	DnaJ homolog subfamily C member 10
9	9606.ENSP00000269881	0.732	Calreticulin-3
10	9606.ENSP00000320866	0.732	Calreticulin
11	9606.ENSP00000361057	0.705	Surfeit locus protein 4
12	9606.ENSP00000262982	0.700	Exportin-2
13	9606.ENSP00000219406	0.696	Protein disulfide-isomerase A2
14	9606.ENSP00000283033	0.696	Thioredoxin domain-containing protein 11
15	9606.ENSP00000286091	0.696	Protein disulfide-isomerase A4
16	9606.ENSP00000300289	0.696	Protein disulfide-isomerase A3
17	9606.ENSP00000327801	0.696	Protein disulfide-isomerase
18	9606.ENSP00000388337	0.696	Protein transport protein Sec61 subunit gamma
19	9606.ENSP00000223641	0.688	Protein transport protein Sec61 subunit beta
20	9606.ENSP00000337688	0.685	Translocation protein SEC62

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015385	0.998	sodium:proton antiporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0001539	0.463	cilium or flagellum-dependent cell motility
GO:0060285	0.453	cilium-dependent cell motility
GO:0065007	0.433	biological regulation
GO:0003341	0.428	cilium movement
GO:0097722	0.425	sperm motility
GO:0060294	0.386	cilium movement involved in cell motility
GO:0050789	0.336	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.990	membrane-bounded organelle
GO:0031090	0.873	organelle membrane
GO:0043231	0.803	intracellular membrane-bounded organelle
GO:0098588	0.643	bounding membrane of organelle
GO:0012505	0.479	endomembrane system
GO:0120025	0.443	plasma membrane bounded cell projection
GO:0098590	0.423	plasma membrane region
GO:0005929	0.387	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29251	0.998	2 H(+)(out) + Na(+)(in) = 2 H(+)(in) + Na(+)(out)

[back to server]