StarFunc result for job id Q5TAX3

User Input

>input (1644 residues)
MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQ
NDICIEKTEVKSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEK
ATSLQAKAEKSPKSPNSVKAEKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQI
GKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLS
KMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKRSPEYT
NCRYLCKLCLIHIENIQGAHKHIKEKRHKKNILEKQEESELRSLPPPSPAHLAALSVAVI
ELAKEHGITDDDLRVRQEIVEEMSKVITTFLPECSLRLYGSSLTRFALKSSDVNIDIKFP
PKMNHPDLLIKVLGILKKNVLYVDVESDFHAKVPVVVCRDRKSGLLCRVSAGNDMACLTT
DLLTALGKIEPVFIPLVLAFRYWAKLCYIDSQTDGGIPSYCFALMVMFFLQQRKPPLLPC
LLGSWIEGFDPKRMDDFQLKGIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKK
TETDNQSNAMKEKHGKSPLALETPNRVSLGQLWLELLKFYTLDFALEEYVICVRIQDILT
RENKNWPKRRIAIEDPFSVKRNVARSLNSQLVYEYVVERFRAAYRYFACPQTKGGNKSTV
DFKKREKGKISNKKPVKSNNMATNGCILLGETTEKINAEREQPVQCDEMDCTSQRCIIDN
NNLLVNELDFADHGQDSSSLSTSKSSEIEPKLDKKQDDLAPSETCLKKELSQCNCIDLSK
SPDPDKSTGTDCRSNLETESSHQSVCTDTSATSCNCKATEDASDLNDDDNLPTQELYYVF
DKFILTSGKPPTIVCSICKKDGHSKNDCPEDFRKIDLKPLPPMTNRFREILDLVCKRCFD
ELSPPCSEQHNREQILIGLEKFIQKEYDEKARLCLFGSSKNGFGFRDSDLDICMTLEGHE
NAEKLNCKEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQH
NTRMLATYAAIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQQRKPPVI
PVLQEIFDGKQIPQRMVDGWNAFFFDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEF
DFKEYVISIRQKKLLTTFEKQWTSKCIAIEDPFDLNHNLGAGVSRKMTNFIMKAFINGRK
LFGTPFYPLIGREAEYFFDSRVLTDGELAPNDRCCRVCGKIGHYMKDCPKRKSLLFRLKK
KDSEEEKEGNEEEKDSRDVLDPRDLHDTRDFRDPRDLRCFICGDAGHVRRECPEVKLARQ
RNSSVAAAQLVRNLVNAQQVAGSAQQQGDQSIRTRQSSECSESPSYSPQPQPFPQNSSQS
AAITQPSSQPGSQPKLGPPQQGAQPPHQVQMPLYNFPQSPPAQYSPMHNMGLLPMHPLQI
PAPSWPIHGPVIHSAPGSAPSNIGLNDPSIIFAQPAARPVAIPNTSHDGHWPRTVAPNSL
VNSGAVGNSEPGFRGLTPPIPWEHAPRPHFPLVPASWPYGLHQNFMHQGNARFQPNKPFY
TQDRCATRRCRERCPHPPRGNVSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RX14	0.644	0.644	0.000	1644	0.875	0.875	B2RX14.pdb.gz	TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus OX=10090 GN=Tut4 PE=1 SV=2
2	AFDB:E9PKY2	0.514	0.695	0.000	1203	0.731	0.998	E9PKY2.pdb.gz	E9PKY2_HUMAN RNA uridylyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
3	AFDB:Q5TAX3	0.999	0.999	0.000	1644	1.000	1.000	Q5TAX3.pdb.gz	TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3
4	AFDB:O64642	0.190	0.398	2.327E-21	764	0.090	0.194	O64642.pdb.gz	URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=URT1 PE=1 SV=2
5	PDB:4ud5B	0.184	0.829	9.644E-21	342	0.064	0.310	4ud5B.pdb.gz
6	PDB:4e7xD	0.179	0.868	6.490E-20	320	0.063	0.325	4e7xD.pdb.gz
7	PDB:3hj1B	0.172	0.654	9.565E-14	387	0.046	0.194	3hj1B.pdb.gz	Structure of the Mitochondrial Editosome-Like Complex Associated TUTase 1 Reveals Divergent Mechanisms of UTP Selection and Domain Organization.
8	PDB:2q0eA	0.158	0.719	3.811E-13	331	0.045	0.224	2q0eA.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
9	PDB:2q0cB	0.150	0.707	1.107E-10	311	0.041	0.219	2q0cB.pdb.gz	Dual role of the RNA substrate in selectivity and catalysis by terminal uridylyl transferases.
10	AFDB:Q38EI4	0.103	0.092	2.175E-10	1857	0.135	0.120	Q38EI4.pdb.gz	Q38EI4_TRYB2 Polymerase nucleotidyl transferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5640 PE=4 SV=1
11	PDB:2b51A	0.169	0.590	7.104E-10	444	0.041	0.153	2b51A.pdb.gz	Structural basis for UTP specificity of RNA editing TUTases from Trypanosoma brucei.
12	PDB:3c66A	0.142	0.402	9.046E-7	529	0.029	0.089	3c66A.pdb.gz	Structure of yeast poly(A) polymerase in complex with a peptide from Fip1, an intrinsically disordered protein.
13	PDB:2nomB	0.092	0.557	4.796E-6	255	0.030	0.196	2nomB.pdb.gz	UTP-bound and Apo Structures of a Minimal RNA Uridylyltransferase.
14	PDB:4rwnA	0.136	0.538	9.660E-5	349	0.026	0.120	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
15	PDB:5wyjCB	0.142	0.206	1.115E-4	1098	0.026	0.038	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	AFDB:M9PGC5	0.045	0.036	6.156E-3	2462	0.099	0.066	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
17	AFDB:P57071	0.048	0.050	3.264E-2	1507	0.117	0.128	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
18	AFDB:O95785	0.043	0.043	2.094E-1	1651	0.114	0.114	O95785.pdb.gz	WIZ_HUMAN Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2
19	AFDB:G5E870	0.045	0.039	2.304E-1	2025	0.075	0.061	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
20	AFDB:Q14669	0.047	0.043	3.711E-1	1992	0.077	0.063	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFM7	0.0	3407	1645	1.000	0.999	A0A0C4DFM7_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
2	B2RX14	0.0	2845	1644	0.877	0.877	TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus OX=10090 GN=Tut4 PE=1 SV=2
3	E9PKX1	0.0	1857	906	0.551	1.000	E9PKX1_HUMAN RNA uridylyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
4	E9PKY2	0.0	1098	1203	0.332	0.453	E9PKY2_HUMAN RNA uridylyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
5	Q5BLK4	0.0	634	1491	0.189	0.208	TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus OX=10090 GN=Tut7 PE=1 SV=3
6	Q5TAX3	0.0	3412	1644	1.000	1.000	TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3
7	Q5VYS8	0.0	628	1495	0.190	0.209	TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1
8	X6R3Q3	0.0	626	784	0.190	0.399	X6R3Q3_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT7 PE=1 SV=1
9	Q09409	7.70e-64	242	1425	0.100	0.115	Q09409_CAEEL RNA uridylyltransferase OS=Caenorhabditis elegans OX=6239 GN=cid-1 PE=1 SV=1
10	O64642	1.13e-47	186	764	0.066	0.141	URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=URT1 PE=1 SV=2
11	Q09408	4.94e-40	159	508	0.059	0.191	Q09408_CAEEL PAP-associated domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pup-2 PE=1 SV=2
12	Q641A1	4.50e-39	155	509	0.061	0.198	GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis OX=8355 GN=tent2-a PE=1 SV=1
13	Q91YI6	1.65e-37	150	484	0.058	0.196	GLD2_MOUSE Poly(A) RNA polymerase GLD2 OS=Mus musculus OX=10090 GN=Tent2 PE=1 SV=1
14	Q5U315	7.99e-37	149	484	0.057	0.194	GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus OX=10116 GN=Tent2 PE=1 SV=1
15	Q6PIY7	5.02e-36	146	484	0.073	0.248	GLD2_HUMAN Poly(A) RNA polymerase GLD2 OS=Homo sapiens OX=9606 GN=TENT2 PE=1 SV=1
16	O13833	2.45e-34	139	405	0.068	0.277	CID1_SCHPO Terminal uridylyltransferase cid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid1 PE=1 SV=2
17	O74326	1.63e-32	135	478	0.052	0.180	CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid11 PE=3 SV=1
18	Q9UT49	2.00e-32	137	578	0.055	0.157	CID13_SCHPO Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cid13 PE=1 SV=1
19	A0A0A8K9B1	4.36e-28	125	874	0.053	0.100	A0A0A8K9B1_HUMAN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens OX=9606 GN=URLC6 PE=2 SV=1
20	Q9H6E5	4.36e-28	125	874	0.053	0.100	STPAP_HUMAN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens OX=9606 GN=TUT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01909 NTP_transf_2	1.9e-06	39.4	Nucleotidyltransferase domain
2	PF03828 PAP_assoc	3e-25	99.5	Cid1 family poly A polymerase
3	PF18765 Polbeta	1.2	20.7	Polymerase beta, Nucleotidyltransferase
4	PF19088 TUTase	2.4e-118	404.8	TUTase nucleotidyltransferase domain
5	PF00098 zf-CCHC	7.9e-08	43.2	Zinc knuckle
6	PF13696 zf-CCHC_2	7.5	17.8	Zinc knuckle
7	PF14392 zf-CCHC_4	0.94	20.5	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257177

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363314	0.995	Protein lin-28 homolog A
2	9606.ENSP00000344401	0.959	Protein lin-28 homolog B
3	9606.ENSP00000313007	0.936	Polyadenylate-binding protein 1
4	9606.ENSP00000388806	0.915	Eukaryotic translation initiation factor 4B
5	9606.ENSP00000425561	0.914	Eukaryotic translation initiation factor 4E
6	9606.ENSP00000326381	0.913	Eukaryotic initiation factor 4A-II
7	9606.ENSP00000416255	0.913	Eukaryotic translation initiation factor 4 gamma 1
8	9606.ENSP00000293831	0.909	Eukaryotic initiation factor 4A-I
9	9606.ENSP00000269349	0.907	Eukaryotic initiation factor 4A-III
10	9606.ENSP00000302768	0.906	Polyadenylate-binding protein-interacting protein 1
11	9606.ENSP00000315569	0.896	DIS3-like exonuclease 2
12	9606.ENSP00000396995	0.817	Non-canonical poly(A) RNA polymerase PAPD5
13	9606.ENSP00000437256	0.800	Endoribonuclease Dicer
14	9606.ENSP00000220592	0.739	Protein argonaute-2
15	9606.ENSP00000264951	0.713	5'-3' exoribonuclease 1
16	9606.ENSP00000425979	0.690	Ribonuclease 3
17	9606.ENSP00000321711	0.684	DIS3-like exonuclease 1
18	9606.ENSP00000238714	0.670	Poly(A) polymerase gamma
19	9606.ENSP00000353575	0.652	Translation initiation factor eIF-2B subunit gamma
20	9606.ENSP00000366135	0.648	Exosome component 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0050265	1.000	RNA uridylyltransferase activity
GO:0061980	0.385	regulatory RNA binding
GO:0035198	0.374	miRNA binding
GO:0003729	0.303	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0061157	0.991	mRNA destabilization
GO:0006401	0.989	RNA catabolic process
GO:0016071	0.980	mRNA metabolic process
GO:0010467	0.975	gene expression
GO:0006396	0.974	RNA processing
GO:0006402	0.968	mRNA catabolic process
GO:0034660	0.958	ncRNA metabolic process
GO:0031123	0.929	RNA 3'-end processing
GO:0031047	0.910	RNA-mediated gene silencing
GO:0032502	0.907	developmental process
GO:0032501	0.907	multicellular organismal process
GO:0000956	0.863	nuclear-transcribed mRNA catabolic process
GO:0034470	0.848	ncRNA processing
GO:0035196	0.839	miRNA processing
GO:0000288	0.732	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0010528	0.669	regulation of transposition
GO:0034661	0.500	ncRNA catabolic process
GO:0010586	0.466	miRNA metabolic process
GO:0010529	0.357	negative regulation of transposition
GO:0000289	0.342	nuclear-transcribed mRNA poly(A) tail shortening
GO:0050896	0.310	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005730	0.994	nucleolus
GO:0032991	0.436	protein-containing complex
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14785	1.000	RNA(n) + UTP = diphosphate + RNA(n)-3'-uridine ribonucleotide
EC:2.7.7.52	1.000	RNA uridylyltransferase.

[back to server]