StarFunc result for job id Q5TB80

User Input

>input (1403 residues)
MANCSQEELDEEFEQFMKELSDDSFENSDKTARQSKKEMKKKDTVPWWITEDDFKDDGLL
GTNVSYLKTKKTSQPVMEIEEESAEKIQFLKSSGTSLLSTDSLETNELVVSELNHSSLGV
GLDTLEEQEEKEQFFARLEKGLTSSIDYSRLNKELDSNDSTHFKALHSNQANAELTDDEH
ENESKHEELAENYSDDFEDEYVGAPLTTKDEEMPSKENSKSEKISVPKQEEEKTGMLANV
VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIA
HSLGDEDKQKIESNTVEDIKSSVKGHPQENEENSKNISTMESDLPTVEELMKPIRIDSFG
ISGFDLQPVSSEKVAERKETEFFSSLPLKMNPNILSQDSQHVNLFFDKNDENVILQKTTN
ESMENSCPQVTEVTATEEHVDKMYLNILRKKITVNSSSLSQDDKINKTYRSQLSSEEEGA
VMGKQVPYKKARSAPPLLKRKPQSGLYASVRSSGYGKPSSPLKMFSTLEKKTSEDIIKSK
NLRSISTSNQPRKKEILSGTKLIKPAALDKPAHKTESCLSTRKKSENPTETDSCIQFQTD
SLGYCGENKEKKLLMFKRVQEAEDKWRGAQALIEQIKATFSEKEKELENKLEELKKQQEK
ELFKLNQDNYILQAKLSSFEETNKKQRWLHFGEAADPVTGEKLKQIQKEIQEQETLLQGY
QQENERLYNQVKDLQEQNKKNEERMFKENQSLFSEVASLKEQMHKSRFLSQVVEDSEPTR
NQNFTDLLAELRMAQKEKDSLLEDIKRLKQDKQALEVDFEKMKKERDQAKDQIAYVTGEK
LYEIKILEETHKQEISRLQKRLQWYAENQELLDKDALRLREANEEIEKLKLEIEKLKAES
GNPSIRQKIRLKDKAADAKKIQDLERQVKEMEGILKRRYPNSLPALILAASAAGDTVDKN
TVEFMEKRIKKLEADLEGKDEDAKKSLRTMEQQFQKMKIQYEQRLEQQEQLLACKLNQHD
SPRIKALEKELDDIKEAHQITVRNLEAEIDVLKHQNAELDVKKNDKDDEDFQSIEFQVEQ
AHAKAKLVRLNEELAAKKREIQDLSKTVERLQKDRRMMLSNQNSKGREEMSAKRAKKDVL
HSSKGNANSFPGTLDSKLYQPHTFTDSHVSEVLQENYRLKNELEGLISEKNELKMKSEAV
MNQFENSMRRVKEDTAAHIASLKASHQREIEKLLCQNAVENSSSKVAELNRKIATQEVLI
RHFQSQVNELQSKQESLVVSEVREEILQKEITKLLEELREAKENHTPEMKHFVGLEKKIK
QMEMRHAQREQELQQIIQQTHQVVETEQNKEVEKWKRLAQLKNRELEKFRTELDSILDVL
RELHRQGVVVPVAFADEMNAPEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TB80	1.000	1.000	0.000	1403	1.000	1.000	Q5TB80.pdb.gz	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
2	AFDB:Q6ZQ06	0.107	0.107	0.000	1403	0.751	0.751	Q6ZQ06.pdb.gz	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
3	AFDB:E7F5E1	0.121	0.124	2.889E-63	1367	0.371	0.380	E7F5E1.pdb.gz	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
4	AFDB:Q9UPV0	0.057	0.055	5.618E-12	1460	0.152	0.146	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
5	AFDB:Q0VF96	0.068	0.071	9.364E-11	1302	0.152	0.164	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
6	AFDB:Q9PTD7	0.060	0.062	1.224E-10	1360	0.153	0.158	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
7	AFDB:A2A870	0.064	0.074	1.400E-10	1173	0.143	0.171	A2A870.pdb.gz	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
8	AFDB:U3JAG9	0.057	0.071	1.484E-7	1113	0.134	0.169	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
9	AFDB:Q5HZI1	0.063	0.072	6.320E-6	1210	0.125	0.145	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
10	AFDB:Q7SZL5	0.054	0.056	1.235E-5	1338	0.114	0.120	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
11	PDB:2wzvB	0.023	0.116	2.159	223	0.007	0.045	2wzvB.pdb.gz	Biological and Structural Characterization of the Mycobacterium Smegmatis Nitroreductase Nfnb, and its Role in Benzothiazinone Resistance
12	PDB:6qdvO	0.048	0.124	6.741	441	0.035	0.111	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
13	PDB:7sqkA	0.047	0.183	9.423	278	0.034	0.173	7sqkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F5E1	0.0	759	1367	0.398	0.408	CE162_DANRE Centrosomal protein of 162 kDa OS=Danio rerio OX=7955 GN=cep162 PE=2 SV=1
2	Q5TB80	0.0	2850	1403	1.000	1.000	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
3	Q6ZQ06	0.0	2043	1403	0.753	0.753	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
4	P32380	0.33	38.1	944	0.039	0.058	SP110_YEAST Spindle pole body component 110 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC110 PE=1 SV=1
5	Q8K371	1.4	35.8	772	0.048	0.087	AMOL2_MOUSE Angiomotin-like protein 2 OS=Mus musculus OX=10090 GN=Amotl2 PE=1 SV=1
6	Q92878	3.4	34.7	1312	0.033	0.036	RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 PE=1 SV=1
7	H2L0I3	7.4	33.5	2323	0.050	0.030	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
8	H2L0I4	7.5	33.5	2392	0.050	0.029	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
9	H2L0I2	8.6	33.5	2396	0.050	0.029	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
10	Q96G01	9.1	33.1	975	0.033	0.048	BICD1_HUMAN Protein bicaudal D homolog 1 OS=Homo sapiens OX=9606 GN=BICD1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02183 HALZ	3.8e+02	12.7	Homeobox associated leucine zipper
2	PF14890 Intein_splicing	2.7	19.2	Intein splicing domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000448012	0.792	Centrosomal protein of 290 kDa
2	9606.ENSP00000251413	0.740	Tubulin gamma-1 chain
3	9606.ENSP00000324292	0.737	Fas-binding factor 1
4	9606.ENSP00000334379	0.729	C2 domain-containing protein 3
5	9606.ENSP00000342510	0.683	Centrosomal protein of 97 kDa
6	9606.ENSP00000306105	0.660	Centrosomal protein of 89 kDa
7	9606.ENSP00000370803	0.660	Centriolar coiled-coil protein of 110 kDa
8	9606.ENSP00000262302	0.646	Cytosolic Fe-S cluster assembly factor NUBP2
9	9606.ENSP00000281142	0.642	Sodium channel and clathrin linker 1
10	9606.ENSP00000380911	0.638	Centrosomal protein of 83 kDa
11	9606.ENSP00000247843	0.611	YEATS domain-containing protein 4
12	9606.ENSP00000380779	0.602	Tectonic-1
13	9606.ENSP00000389998	0.600	Meckelin
14	9606.ENSP00000278935	0.590	Centrosomal protein of 164 kDa
15	9606.ENSP00000233027	0.578	Serine/threonine-protein kinase Nek4
16	9606.ENSP00000358703	0.578	Protein ripply2
17	9606.ENSP00000261813	0.568	Prefoldin subunit 1
18	9606.ENSP00000316681	0.563	Centrosomal protein of 295 kDa
19	9606.ENSP00000478962	0.554	Protein chibby homolog 1
20	9606.ENSP00000302441	0.549	N-acylneuraminate-9-phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0060271	0.984	cilium assembly
GO:0050794	0.514	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005814	1.000	centriole
GO:0034451	0.999	centriolar satellite
GO:0005654	0.998	nucleoplasm
GO:0005929	0.997	cilium
GO:0005874	0.990	microtubule
GO:0005879	0.978	axonemal microtubule
GO:0012505	0.536	endomembrane system
GO:0032991	0.485	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]