StarFunc result for job id Q5TBA9

User Input

>input (1400 residues)
MASQQDSGFFEISIKYLLKSWSNTSPVGNGYIKPPVPPASGTHREKGPPTMLPINVDPDS
KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYC
LPSILRTLFDWYKRQNGIEDESHEYRPRTSNKSKSDEQQRDYLMERRDLAIDFIFSLVLI
EVLKQIPLHPVIDSLIHDVINLAFKHFKYKEGYLGPNTGNMHIVADLYAEVIGVLAQAKF
PAVKKKFMAELKELRHKEQNPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHY
FLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLA
LYPLVTCLLCVSQKQLFLNRWHIFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKC
ESNTATQSRLITIITTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLC
VGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMPVTGAVLPSGNTLRVKKTYLSK
TLTEEEAKMIGMSLYYSQVRKAVDNILRHLDKEVGRCMMLTNVQMLNKEPEDMITGERKP
KIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWRE
DVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKVYEQANKIRNSELIA
NGSSHRIQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFIALGQPEDD
DRPMIDVMDQLSSSILESFIHVAVSDSATLPLTHNVDLQWLVEWNAVLVNSHYDVKSPSH
VWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPINAK
KTSTAGSGDNYVTLWRNYLILCFGVAKPSIMSPGHLRASTPEIMATTPDGTVSYDNKAIG
TPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENK
KRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTRMLLEAEN
DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTP
LDRYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQ
LGCEVVVLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIATVCGSRNYPFDIVTLLN
LVLFKASDTNREIYEISMQLMQILEAKLFVYSKKVAEQRPGSILYGTHGPLPPLYSVSLA
LLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVDSRLLLPGSS
PSSPEDEVKDREGDVTASHG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HDV6	0.426	0.295	2.261E-32	2196	0.192	0.122	Q9HDV6.pdb.gz	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
2	AFDB:P40468	0.519	0.332	2.896E-29	2376	0.194	0.114	P40468.pdb.gz	TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAO3 PE=1 SV=1
3	PDB:7pgsN	0.379	0.320	6.272E-13	1787	0.141	0.110	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
4	PDB:7mp6B	0.373	0.339	3.078E-11	1609	0.122	0.106	7mp6B.pdb.gz
5	PDB:7r04A	0.341	0.236	1.209E-10	2326	0.131	0.079	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
6	PDB:7r04B	0.345	0.249	1.907E-10	2229	0.132	0.083	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
7	PDB:7pgrN	0.346	0.238	3.713E-10	2423	0.136	0.079	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
8	PDB:7r03B	0.318	0.227	1.800E-9	2246	0.124	0.077	7r03B.pdb.gz
9	PDB:7mp5A	0.332	0.295	3.384E-9	1629	0.115	0.099	7mp5A.pdb.gz
10	AFDB:Q10105	0.140	0.088	3.457E-9	2670	0.130	0.068	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
11	AFDB:Q5BBG0	0.208	0.249	1.139E-8	1093	0.111	0.142	Q5BBG0.pdb.gz	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
12	AFDB:Q95Q95	0.209	0.130	1.180E-8	2697	0.109	0.057	Q95Q95.pdb.gz	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
13	AFDB:P32600	0.249	0.154	2.644E-8	2474	0.111	0.063	P32600.pdb.gz	TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR2 PE=1 SV=3
14	AFDB:Q93VS8	0.192	0.228	5.332E-8	1116	0.104	0.130	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
15	AFDB:Q86XI2	0.141	0.162	6.816E-8	1143	0.106	0.130	Q86XI2.pdb.gz	CNDG2_HUMAN Condensin-2 complex subunit G2 OS=Homo sapiens OX=9606 GN=NCAPG2 PE=1 SV=1
16	AFDB:Q586K4	0.147	0.164	9.680E-8	1219	0.107	0.123	Q586K4.pdb.gz	Q586K4_TRYB2 Exportin-T OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.145 PE=3 SV=1
17	AFDB:F4I8B3	0.170	0.189	1.075E-7	1203	0.098	0.114	F4I8B3.pdb.gz	F4I8B3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HEB1 PE=1 SV=1
18	PDB:6kwyc	0.197	0.163	3.593E-7	1811	0.134	0.103	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
19	PDB:7unkA	0.200	0.248	5.102E-7	1047	0.111	0.149	7unkA.pdb.gz
20	PDB:6xu2A	0.209	0.253	8.049E-7	1091	0.087	0.112	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JMD7	0.0	1938	3142	0.685	0.305	B8JMD7_DANRE Furry homolog,-like OS=Danio rerio OX=7955 GN=fc84g03 PE=1 SV=1
2	E9Q8I9	0.0	2875	3020	0.986	0.457	FRY_MOUSE Protein furry homolog OS=Mus musculus OX=10090 GN=Fry PE=1 SV=1
3	O94915	0.0	1938	3013	0.680	0.316	FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2
4	Q5DX48	0.0	608	2886	0.238	0.115	Q5DX48_CAEEL MOR2-PAG1_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sax-2 PE=1 SV=1
5	Q9VT28	0.0	843	3479	0.288	0.116	FRY_DROME Protein furry OS=Drosophila melanogaster OX=7227 GN=fry PE=1 SV=2
6	Q9HDV6	2.62e-28	127	2196	0.079	0.051	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
7	A0A1D8PJ86	3.61e-26	120	2830	0.093	0.046	A0A1D8PJ86_CANAL Cas4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAS4 PE=4 SV=1
8	P40468	2.34e-19	97.8	2376	0.049	0.029	TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAO3 PE=1 SV=1
9	Q6NR70	0.088	40.0	1248	0.026	0.030	Q6NR70_DROME Neuroligin OS=Drosophila melanogaster OX=7227 GN=Nlg2 PE=2 SV=1
10	Q9NGK5	0.088	40.0	1248	0.026	0.030	Q9NGK5_DROME FI21425p1 OS=Drosophila melanogaster OX=7227 GN=Nlg2 PE=2 SV=1
11	Q5SQL3	0.27	38.1	1165	0.024	0.028	Q5SQL3_HUMAN Homeodomain interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
12	Q86Z02	0.27	38.1	1210	0.024	0.027	HIPK1_HUMAN Homeodomain-interacting protein kinase 1 OS=Homo sapiens OX=9606 GN=HIPK1 PE=1 SV=1
13	O88904	0.40	37.7	1210	0.024	0.027	HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2
14	A0A1D8PFE8	1.7	35.8	2643	0.011	0.006	A0A1D8PFE8_CANAL Ras GTPase activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IRA2 PE=4 SV=1
15	E9AC93	1.8	35.4	942	0.015	0.022	E9AC93_LEIMA Phosphoglycan beta 1,2 arabinosyltransferase OS=Leishmania major OX=5664 GN=SCA2 PE=4 SV=1
16	E9AC97	1.8	35.4	942	0.015	0.022	E9AC97_LEIMA Phosphoglycan beta 1,2 arabinosyltransferase OS=Leishmania major OX=5664 GN=SCA1 PE=4 SV=1
17	O01397	3.3	34.7	2802	0.022	0.011	O01397_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=4 SV=1
18	O01398	3.3	34.7	2802	0.022	0.011	O01398_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=2 SV=1
19	O01399	3.3	34.7	2764	0.022	0.011	O01399_DROME Neurofibromin OS=Drosophila melanogaster OX=7227 GN=Nf1 PE=2 SV=1
20	Q9FNN3	4.7	34.3	908	0.021	0.033	ILP1_ARATH Transcriptional repressor ILP1 OS=Arabidopsis thaliana OX=3702 GN=ILP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11391 DUF2798	3.5e+02	12.7	Protein of unknown function (DUF2798)
2	PF14228 MOR2-PAG1_mid	1.3e-10	51.3	Cell morphogenesis central region
3	PF14222 MOR2-PAG1_N	3.6e-163	556.2	Cell morphogenesis N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229812	0.822	Serine/threonine-protein kinase 38
2	9606.ENSP00000373684	0.822	Serine/threonine-protein kinase 38-like
3	9606.ENSP00000251472	0.728	Microtubule-associated serine/threonine-protein kinase 1
4	9606.ENSP00000381098	0.707	Glutamate receptor-interacting protein 1
5	9606.ENSP00000301037	0.681	Uncharacterized serine/threonine-protein kinase SgK494
6	9606.ENSP00000262231	0.602	Regulating synaptic membrane exocytosis protein 2
7	9606.ENSP00000479669	0.576	Calcium-binding protein 39-like
8	9606.ENSP00000347730	0.562	Zinc finger protein 536
9	9606.ENSP00000258418	0.550	Calcium-binding protein 39
10	9606.ENSP00000313391	0.535	Disabled homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.998	molecular function regulator activity
GO:0030234	0.887	enzyme regulator activity
GO:0140678	0.807	molecular function inhibitor activity
GO:0004857	0.773	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.892	regulation of biological process
GO:0090311	0.827	regulation of protein deacetylation
GO:0048519	0.779	negative regulation of biological process
GO:0051248	0.689	negative regulation of protein metabolic process
GO:0031400	0.541	negative regulation of protein modification process
GO:0050794	0.474	regulation of cellular process
GO:0009987	0.359	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0042995	0.976	cell projection
GO:0120025	0.957	plasma membrane bounded cell projection
GO:0036477	0.856	somatodendritic compartment
GO:0097447	0.849	dendritic tree
GO:0044297	0.839	cell body
GO:0030425	0.829	dendrite
GO:0043226	0.828	organelle
GO:0071944	0.788	cell periphery
GO:0030054	0.763	cell junction
GO:0030424	0.725	axon
GO:0043229	0.720	intracellular organelle
GO:0005938	0.541	cell cortex
GO:0043227	0.443	membrane-bounded organelle
GO:0043231	0.412	intracellular membrane-bounded organelle
GO:0043228	0.410	non-membrane-bounded organelle
GO:0043232	0.398	intracellular non-membrane-bounded organelle
GO:0045202	0.372	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]