StarFunc result for job id Q5TBC7

User Input

>input (163 residues)
MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRML
GDQFNGELEASAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLL
EYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWENLES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TBC7	1.000	1.000	5.219E-23	163	1.000	1.000	Q5TBC7.pdb.gz	B2L15_HUMAN Bcl-2-like protein 15 OS=Homo sapiens OX=9606 GN=BCL2L15 PE=1 SV=1
2	PDB:7cclC	0.847	0.936	1.260E-17	147	0.890	0.986	7cclC.pdb.gz
3	AFDB:Q08ED0	0.909	0.888	7.063E-16	167	0.706	0.689	Q08ED0.pdb.gz	B2L15_MOUSE Bcl-2-like protein 15 OS=Mus musculus OX=10090 GN=Bcl2l15 PE=2 SV=2
4	AFDB:A8ASI8	0.630	0.540	5.238E-3	195	0.190	0.159	A8ASI8.pdb.gz	A8ASI8_HUMAN BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=2 SV=1
5	AFDB:O08734	0.534	0.440	6.060E-3	209	0.184	0.144	O08734.pdb.gz	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
6	AFDB:P70444	0.663	0.567	6.361E-3	195	0.221	0.185	P70444.pdb.gz	BID_MOUSE BH3-interacting domain death agonist OS=Mus musculus OX=10090 GN=Bid PE=1 SV=2
7	AFDB:Q9JLT6	0.634	0.541	1.034E-2	196	0.160	0.133	Q9JLT6.pdb.gz	BID_RAT BH3-interacting domain death agonist OS=Rattus norvegicus OX=10116 GN=Bid PE=1 SV=2
8	AFDB:O35425	0.479	0.393	1.256E-2	213	0.160	0.122	O35425.pdb.gz	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
9	AFDB:F1QTZ0	0.495	0.410	3.657E-2	207	0.160	0.126	F1QTZ0.pdb.gz
10	PDB:1lxlA	0.456	0.361	4.053E-2	221	0.178	0.131	1lxlA.pdb.gz
11	AFDB:A0A0D9S330	0.482	0.426	7.956E-2	192	0.153	0.130	A0A0D9S330.pdb.gz	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
12	AFDB:Q16611	0.468	0.386	7.956E-2	211	0.166	0.128	Q16611.pdb.gz	BAK_HUMAN Bcl-2 homologous antagonist/killer OS=Homo sapiens OX=9606 GN=BAK1 PE=1 SV=1
13	PDB:2k7wA	0.424	0.377	9.258E-2	192	0.166	0.141	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
14	PDB:5w62A	0.404	0.418	9.258E-2	156	0.172	0.179	5w62A.pdb.gz
15	PDB:4wmuA	0.473	0.171	9.718E-2	516	0.141	0.045	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
16	PDB:2bidA	0.520	0.446	2.568E-1	197	0.172	0.142	2bidA.pdb.gz
17	PDB:1ddbA	0.492	0.431	2.830E-1	195	0.172	0.144	1ddbA.pdb.gz
18	PDB:1o0lA	0.433	0.387	5.865E-1	188	0.184	0.160	1o0lA.pdb.gz
19	PDB:1fdhG	0.227	0.245	1.550	147	0.135	0.150	1fdhG.pdb.gz	Structure of human foetal deoxyhaemoglobin.
20	PDB:7yqcA	0.144	0.123	1.627	198	0.129	0.106	7yqcA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TBC7	1.06e-119	336	163	1.000	1.000	B2L15_HUMAN Bcl-2-like protein 15 OS=Homo sapiens OX=9606 GN=BCL2L15 PE=1 SV=1
2	Q08ED0	1.47e-78	232	167	0.712	0.695	B2L15_MOUSE Bcl-2-like protein 15 OS=Mus musculus OX=10090 GN=Bcl2l15 PE=2 SV=2
3	P05014	2.7	30.0	189	0.110	0.095	IFNA4_HUMAN Interferon alpha-4 OS=Homo sapiens OX=9606 GN=IFNA4 PE=1 SV=2
4	P01566	2.9	30.0	189	0.110	0.095	IFN10_HUMAN Interferon alpha-10 OS=Homo sapiens OX=9606 GN=IFNA10 PE=1 SV=1
5	P01571	4.3	29.6	189	0.110	0.095	IFN17_HUMAN Interferon alpha-17 OS=Homo sapiens OX=9606 GN=IFNA17 PE=1 SV=2
6	G3XCU5	4.7	29.6	319	0.141	0.072	G3XCU5_PSEAE Sigma factor regulator, VreR OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vreR PE=4 SV=1
7	O69006	4.7	29.6	319	0.141	0.072	O69006_PSEAI Anti-sigma factor VreR OS=Pseudomonas aeruginosa OX=287 GN=pigE PE=4 SV=1
8	Q9EPA7	5.5	29.6	285	0.117	0.067	NMNA1_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Mus musculus OX=10090 GN=Nmnat1 PE=1 SV=2
9	O35945	7.5	29.3	501	0.215	0.070	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
10	P01567	8.0	28.9	189	0.110	0.095	IFNA7_HUMAN Interferon alpha-7 OS=Homo sapiens OX=9606 GN=IFNA7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	3e+02	13.5	Apoptosis regulator proteins, Bcl-2 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309132	0.766	Apoptosis facilitator Bcl-2-like protein 14
2	9606.ENSP00000358617	0.712	Putative homeodomain transcription factor 1
3	9606.ENSP00000323304	0.625	Leucine rich single-pass membrane protein 1
4	9606.ENSP00000363999	0.598	Mitochondrial ribosomal protein L50
5	9606.ENSP00000418086	0.594	Uncharacterized protein C3orf14
6	9606.ENSP00000261441	0.579	Lysine-specific demethylase 9
7	9606.ENSP00000287474	0.577	Ferric-chelate reductase 1
8	9606.ENSP00000358582	0.571	AP-4 complex subunit beta-1
9	9606.ENSP00000312535	0.560	Leucine-rich repeat and fibronectin type-III domain-containing protein 4
10	9606.ENSP00000333358	0.543	Inactive ribonuclease-like protein 10
11	9606.ENSP00000304604	0.536	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.964	positive regulation of biological process
GO:0009987	0.927	cellular process
GO:0010941	0.855	regulation of cell death
GO:0048522	0.832	positive regulation of cellular process
GO:0050896	0.788	response to stimulus
GO:0043067	0.781	regulation of programmed cell death
GO:0042981	0.674	regulation of apoptotic process
GO:0043068	0.537	positive regulation of programmed cell death
GO:0019222	0.462	regulation of metabolic process
GO:0060255	0.423	regulation of macromolecule metabolic process
GO:0080090	0.411	regulation of primary metabolic process
GO:0051171	0.411	regulation of nitrogen compound metabolic process
GO:0048519	0.388	negative regulation of biological process
GO:0009893	0.366	positive regulation of metabolic process
GO:0048523	0.334	negative regulation of cellular process
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:0043065	0.309	positive regulation of apoptotic process
GO:0065009	0.303	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.999	nucleus
GO:0016020	0.859	membrane
GO:0005739	0.557	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]