StarFunc result for job id Q5TC82

User Input

>input (1133 residues)
MPVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTINTD
IELLPVNSALLQLVGAQVPEQQPITLCSGVEDTKHYEEAKKCVEELALYLKPLSSARGVG
LNSTTQSVLSRPMQRKLVTLVHCQLVEEEGRIRAMRAARSLGERTVTELILQHQNPQQLS
SNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKT
SIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAP
DQWSSLLYGDQSHKSHMQSIIDKLQTPASFAQSVQELTIALQRTGDPANLNRLRPHLELL
ANIDPSPDAPPPTWEQLENGLVAVRTVVHGLVDYIQNHSKKGADQQQPPQHSKYKTYMCR
DMKQRGGCPRGASCTFAHSQEELEKFRKMNKRLVPRRPLSASLGQLNEVGLPSAAILPDE
GAVDLPSRKPPALPNGIVSTGNTVTQLIPRGTDPSYDSSLKPGKIDHLSSSAPGSPPDLL
ESVPKSISALPVNPHSIPPRGPADLPPMPVTKPLQMVPRGSQLYPAQQTDVYYQDPRGAA
PPFEPAPYQQGMYYTPPPQCVSRFVRPPPSAPEPAPPYLDHYPPYLQERVVNSQYGTQPQ
QYPPIYPSHYDGRRVYPAPSYTREEIFRESPIPIEIPPAAVPSYVPESRERYQQIESYYP
VAPHPTQIRPSYLREPPYSRLPPPPQPHPSLDELHRRRKEIMAQLEERKVISPPPFAPSP
TLPPTFHPEEFLDEDLKVAGKYKGNDYSQYSPWSCDTIGSYIGTKDAKPKDVVAAGSVEM
MNVESKGMRDQRLDLQRRAAETSDDDLIPFGDRPTVSRFGAISRTSKTIYQGAGPMQAMA
PQGAPTKSINISDYSPYGTHGGWGASPYSPHQNIPSQGHFSERERISMSEVASHGKPLPS
AEREQLRLELQQLNHQISQQTQLRGLEAVSNRLVLQREANTLAGQSQPPPPPPPKWPGMI
SSEQLSLELHQVEREIGKRTRELSMENQCSLDMKSKLNTSKQAENGQPEPQNKVPAEDLT
LTFSDVPNGSALTQENISLLSNKTSSLNLSEDPEGGGDNNDSQRSGVTPSSAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TC82	0.999	0.999	0.000	1133	1.000	1.000	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
2	AFDB:A0A024R899	0.395	0.376	3.263E-69	1191	0.509	0.484	A0A024R899.pdb.gz
3	AFDB:A0A0B4K822	0.050	0.050	6.784E-3	1136	0.131	0.130	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
4	AFDB:E9PD50	0.066	0.065	9.581E-3	1170	0.148	0.144	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
5	AFDB:Q3ULZ2	0.056	0.056	1.911E-2	1149	0.128	0.126	Q3ULZ2.pdb.gz	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
6	AFDB:Q96QP1	0.076	0.071	2.818E-2	1244	0.120	0.109	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
7	AFDB:Q9VUH6	0.040	0.030	2.818E-2	1833	0.166	0.103	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
8	AFDB:Q24167	0.057	0.045	3.072E-2	1507	0.092	0.069	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
9	AFDB:A2A935	0.057	0.052	4.338E-2	1275	0.132	0.117	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
10	AFDB:Q92540	0.070	0.070	4.338E-2	1137	0.132	0.132	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
11	PDB:2nyxB	0.063	0.359	1.821E-1	147	0.019	0.143	2nyxB.pdb.gz
12	PDB:7mexA	0.061	0.044	2.685E-1	1737	0.037	0.024	7mexA.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
13	PDB:6xhiA	0.053	0.088	2.803E-1	473	0.042	0.101	6xhiA.pdb.gz	Structural analysis of the Sulfolobus solfataricus TF55beta chaperonin by cryo-electron microscopy
14	PDB:5afqB	0.062	0.135	2.927E-1	444	0.034	0.086	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
15	PDB:3cuqA	0.057	0.243	3.332E-1	219	0.015	0.078	3cuqA.pdb.gz
16	PDB:3zqeA	0.046	0.124	3.632E-1	272	0.028	0.118	3zqeA.pdb.gz	Crystal Structure of Prgi-Sipd: Insight Into a Secretion Competent State of the Type Three Secretion System Needle Tip and its Interaction with Host Ligands
17	PDB:2fe3B	0.059	0.367	4.134E-1	143	0.012	0.098	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
18	PDB:1l7vA	0.061	0.143	4.316E-1	324	0.034	0.117	1l7vA.pdb.gz	The E. coli BtuCD structure: a framework for ABC transporter architecture and mechanism.
19	PDB:4zzlA	0.062	0.312	4.705E-1	146	0.019	0.151	4zzlA.pdb.gz
20	PDB:4b2te	0.057	0.108	5.129E-1	359	0.032	0.100	4b2te.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C090	0.0	1009	1187	0.518	0.495	RC3H2_MOUSE Roquin-2 OS=Mus musculus OX=10090 GN=Rc3h2 PE=1 SV=1
2	Q4VGL6	0.0	2137	1130	0.936	0.939	RC3H1_MOUSE Roquin-1 OS=Mus musculus OX=10090 GN=Rc3h1 PE=1 SV=1
3	Q5TC82	0.0	2316	1133	1.000	1.000	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
4	Q9HBD1	0.0	1014	1191	0.521	0.495	RC3H2_HUMAN Roquin-2 OS=Homo sapiens OX=9606 GN=RC3H2 PE=1 SV=2
5	Q9VV48	0.0	603	819	0.273	0.377	Q9VV48_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=roq PE=1 SV=1
6	O45962	5.24e-99	338	952	0.162	0.193	RLE1_CAEEL Regulation of longevity by E3 ubiquitin-protein ligase OS=Caenorhabditis elegans OX=6239 GN=rle-1 PE=1 SV=4
7	G5ED20	1.16e-05	52.0	944	0.019	0.023	G5ED20_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tam-1 PE=1 SV=1
8	Q8CH72	1.16e-05	52.0	655	0.026	0.046	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
9	Q13049	4.09e-05	50.1	653	0.026	0.044	TRI32_HUMAN E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens OX=9606 GN=TRIM32 PE=1 SV=2
10	O01481	8.41e-05	48.1	283	0.022	0.088	O01481_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C06A5.8 PE=1 SV=1
11	Q9U5C1	1.06e-04	47.8	295	0.025	0.095	Q9U5C1_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F43C11.7 PE=4 SV=1
12	O17099	0.001	45.1	374	0.022	0.067	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1
13	Q7Z6J0	0.001	45.4	888	0.020	0.026	SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens OX=9606 GN=SH3RF1 PE=1 SV=2
14	Q08AM8	0.002	44.7	729	0.020	0.032	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
15	Q8TEC5	0.002	44.7	729	0.020	0.032	SH3R2_HUMAN E3 ubiquitin-protein ligase SH3RF2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=3
16	A0A0R4IL45	0.003	44.3	663	0.021	0.036	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
17	A8WGA9	0.003	44.3	663	0.021	0.036	A8WGA9_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=2 SV=1
18	Q381U0	0.003	41.6	139	0.018	0.144	Q381U0_TRYB2 Zinc finger protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6590 PE=4 SV=1
19	Q498M5	0.003	44.3	735	0.020	0.031	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
20	Q7YXD9	0.003	43.5	419	0.045	0.122	Q7YXD9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	2e+02	13.3	Baculovirus immediate-early protein (IE-0)
2	PF01363 FYVE	7.7	18.1	FYVE zinc finger
3	PF05138 PaaA_PaaC	62	14.2	Phenylacetic acid catabolic protein
4	PF14447 Prok-RING_4	0.037	25.2	Prokaryotic RING finger family 4
5	PF18386 ROQ_II	5.5e-30	114.3	Roquin II domain
6	PF05332 Vesi_VP2	1.3e+02	14.0	Vesivirus VP2 protein
7	PF00097 zf-C3HC4	0.57	21.4	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	5.7	18.2	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.081	24.1	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	0.28	22.6	zinc finger of C3HC4-type, RING
11	PF00642 zf-CCCH	0.93	20.8	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
12	PF18044 zf-CCCH_4	1.4e+02	13.6	CCCH-type zinc finger
13	PF16685 zf-RING_10	6.3e+02	11.9	zinc RING finger of MSL2
14	PF13639 zf-RING_2	0.081	24.6	Ring finger domain
15	PF14570 zf-RING_4	4.6e+02	12.0	RING/Ubox like zinc-binding domain
16	PF14634 zf-RING_5	0.034	25.4	zinc-RING finger domain
17	PF14835 zf-RING_6	8.2e+02	11.3	zf-RING of BARD1-type protein
18	PF13445 zf-RING_UBOX	0.011	27.0	RING-type zinc-finger
19	PF18345 zf_CCCH_4	31	16.0	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351811	0.907	Enhancer of mRNA-decapping protein 4
2	9606.ENSP00000478754	0.901	Probable ATP-dependent RNA helicase DDX6
3	9606.ENSP00000320949	0.892	CCR4-NOT transcription complex subunit 1
4	9606.ENSP00000229195	0.879	CCR4-NOT transcription complex subunit 2
5	9606.ENSP00000225388	0.878	Nuclear fragile X mental retardation-interacting protein 2
6	9606.ENSP00000351159	0.872	CCR4-NOT transcription complex subunit 3
7	9606.ENSP00000220592	0.847	Protein argonaute-2
8	9606.ENSP00000362774	0.847	Roquin-2
9	9606.ENSP00000470142	0.814	Regulator of nonsense transcripts 1
10	9606.ENSP00000273064	0.800	CCR4-NOT transcription complex subunit 9
11	9606.ENSP00000355279	0.796	CCR4-NOT transcription complex subunit 7
12	9606.ENSP00000399862	0.792	CCR4-NOT transcription complex subunit 10
13	9606.ENSP00000289382	0.778	CCR4-NOT transcription complex subunit 11
14	9606.ENSP00000351524	0.774	Probable helicase with zinc finger domain
15	9606.ENSP00000319476	0.771	Inducible T-cell costimulator
16	9606.ENSP00000362179	0.734	Endoribonuclease ZC3H12A
17	9606.ENSP00000264951	0.724	5'-3' exoribonuclease 1
18	9606.ENSP00000363596	0.720	Cannabinoid receptor 2
19	9606.ENSP00000409279	0.688	OTU domain-containing protein 4
20	9606.ENSP00000437271	0.686	182 kDa tankyrase-1-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035613	0.999	RNA stem-loop binding
GO:0061630	0.995	ubiquitin protein ligase activity
GO:0003725	0.976	double-stranded RNA binding
GO:0044877	0.905	protein-containing complex binding
GO:1905762	0.625	CCR4-NOT complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.982	primary metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0044237	0.981	cellular metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0009056	0.968	catabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0010468	0.960	regulation of gene expression
GO:0051252	0.958	regulation of RNA metabolic process
GO:0009892	0.955	negative regulation of metabolic process
GO:0031326	0.954	regulation of cellular biosynthetic process
GO:0010605	0.954	negative regulation of macromolecule metabolic process
GO:0010608	0.949	post-transcriptional regulation of gene expression
GO:0034641	0.943	cellular nitrogen compound metabolic process
GO:0010629	0.943	negative regulation of gene expression
GO:0048523	0.926	negative regulation of cellular process
GO:0019538	0.918	protein metabolic process
GO:0044260	0.902	cellular macromolecule metabolic process
GO:0009894	0.897	regulation of catabolic process
GO:0010556	0.894	regulation of macromolecule biosynthetic process
GO:0046483	0.893	heterocycle metabolic process
GO:0048518	0.886	positive regulation of biological process
GO:0048522	0.881	positive regulation of cellular process
GO:0065008	0.880	regulation of biological quality
GO:0051246	0.877	regulation of protein metabolic process
GO:0006139	0.875	nucleobase-containing compound metabolic process
GO:0090304	0.874	nucleic acid metabolic process
GO:2000112	0.869	regulation of cellular macromolecule biosynthetic process
GO:0034249	0.867	negative regulation of amide metabolic process
GO:1903311	0.867	regulation of mRNA metabolic process
GO:0017148	0.864	negative regulation of translation
GO:0016070	0.861	RNA metabolic process
GO:0070647	0.853	protein modification by small protein conjugation or removal
GO:0031329	0.850	regulation of cellular catabolic process
GO:0043488	0.839	regulation of mRNA stability
GO:1901575	0.834	organic substance catabolic process
GO:0061014	0.816	positive regulation of mRNA catabolic process
GO:0050779	0.808	RNA destabilization
GO:0061157	0.799	mRNA destabilization
GO:0044265	0.764	cellular macromolecule catabolic process
GO:0016071	0.734	mRNA metabolic process
GO:0006401	0.731	RNA catabolic process
GO:0000209	0.696	protein polyubiquitination
GO:0050896	0.672	response to stimulus
GO:0000956	0.649	nuclear-transcribed mRNA catabolic process
GO:0071840	0.480	cellular component organization or biogenesis
GO:0051716	0.472	cellular response to stimulus
GO:0002682	0.444	regulation of immune system process
GO:0051239	0.417	regulation of multicellular organismal process
GO:0048583	0.415	regulation of response to stimulus
GO:0010467	0.335	gene expression
GO:0002694	0.330	regulation of leukocyte activation
GO:0002684	0.323	positive regulation of immune system process
GO:0050776	0.321	regulation of immune response
GO:0002683	0.320	negative regulation of immune system process
GO:0009967	0.319	positive regulation of signal transduction
GO:0050793	0.315	regulation of developmental process
GO:0002695	0.310	negative regulation of leukocyte activation
GO:0016043	0.303	cellular component organization
GO:0050778	0.301	positive regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0035770	0.995	ribonucleoprotein granule
GO:0036464	0.993	cytoplasmic ribonucleoprotein granule
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0000932	0.957	P-body
GO:0016020	0.917	membrane
GO:0005634	0.880	nucleus
GO:0005829	0.843	cytosol
GO:0070013	0.605	intracellular organelle lumen
GO:0031981	0.602	nuclear lumen
GO:0032991	0.509	protein-containing complex
GO:0010494	0.508	cytoplasmic stress granule
GO:0005654	0.453	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]