StarFunc result for job id Q5TC84

User Input

>input (451 residues)
MGNLLGGVSFREPTTVEDCDSTWQTDSEPEPEEPGPGGGSEGPGQESEQPAQPPEQAGGR
PGASPAPDEDAEAAGAEQGGDSTEATAKPKRSFYAARDLYKYRHQYPNFKDIRYQNDLSN
LRFYKNKIPFKPDGVYIEEVLSKWKGDYEKLEHNHTYIQWLFPLREQGLNFYAKELTTYE
IEEFKKTKEAIRRFLLAYKMMLEFFGIKLTDKTGNVARAVNWQERFQHLNESQHNYLRIT
RILKSLGELGYESFKSPLVKFILHEALVENTIPNIKQSALEYFVYTIRDRRERRKLLRFA
QKHYTPSENFIWGPPRKEQSEGSKAQKMSSPLASSHNSQTSMHKKAKDSKNSSSAVHLNS
KTAEDKKVAPKEPVEETDRPSPEPSNEAAKPRNTEKDSNAENMNSQPEKTVTTPTEKKES
VSPENNEEGGNDNQDNENPGNTNCHDVVLVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C7R7	0.096	0.057	3.436E-2	927	0.120	0.058	Q8C7R7.pdb.gz	RFX6_MOUSE DNA-binding protein RFX6 OS=Mus musculus OX=10090 GN=Rfx6 PE=1 SV=2
2	AFDB:Q8HWS3	0.126	0.079	8.260E-2	928	0.111	0.054	Q8HWS3.pdb.gz	RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens OX=9606 GN=RFX6 PE=1 SV=2
3	AFDB:A0A1D8PRB9	0.097	0.058	1.461E-1	1045	0.142	0.061	A0A1D8PRB9.pdb.gz	A0A1D8PRB9_CANAL Arf family guanine nucleotide exchange factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C703480WA PE=4 SV=1
4	AFDB:Q5RJA1	0.098	0.062	2.075E-1	848	0.109	0.058	Q5RJA1.pdb.gz	RFX6_DANRE DNA-binding protein RFX6 OS=Danio rerio OX=7955 GN=rfx6 PE=2 SV=2
5	AFDB:F1QZ18	0.116	0.103	2.367E-1	531	0.113	0.096	F1QZ18.pdb.gz	F1QZ18_DANRE Melanopsin opn4x1 OS=Danio rerio OX=7955 GN=opn4x1 PE=2 SV=2
6	AFDB:P42331	0.088	0.068	2.821E-1	645	0.084	0.059	P42331.pdb.gz	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
7	AFDB:Q6FK29	0.094	0.078	3.670E-1	601	0.104	0.078	Q6FK29.pdb.gz	Q6FK29_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SAC7 PE=4 SV=1
8	PDB:3ts1A	0.083	0.104	4.099E-1	317	0.055	0.079	3ts1A.pdb.gz	Structure of tyrosyl-tRNA synthetase refined at 2.3 A resolution. Interaction of the enzyme with the tyrosyl adenylate intermediate.
9	PDB:7yqcA	0.094	0.164	4.885E-1	198	0.051	0.116	7yqcA.pdb.gz
10	AFDB:P38856	0.104	0.082	5.213E-1	637	0.133	0.094	P38856.pdb.gz	AP18A_YEAST Clathrin coat assembly protein AP180A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP1801 PE=1 SV=1
11	AFDB:Q2U5X6	0.098	0.065	5.213E-1	775	0.118	0.068	Q2U5X6.pdb.gz	Q2U5X6_ASPOR PH signal transduction protein PalH OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000469 PE=4 SV=1
12	AFDB:P9WJV5	0.089	0.053	5.447E-1	944	0.109	0.052	P9WJV5.pdb.gz	MMPL3_MYCTU Trehalose monomycolate exporter MmpL3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmpL3 PE=1 SV=1
13	PDB:7ohrI	0.130	0.138	1.124	409	0.055	0.061	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
14	PDB:3wyfC	0.147	0.083	1.175	1040	0.078	0.034	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
15	PDB:7f1qR	0.114	0.130	1.282	367	0.031	0.038	7f1qR.pdb.gz
16	PDB:4in3D	0.103	0.081	1.340	632	0.084	0.060	4in3D.pdb.gz
17	PDB:4a0cA	0.137	0.070	2.171	1155	0.058	0.023	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:1wa5C	0.149	0.085	2.268	950	0.075	0.036	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
19	PDB:3gjxA	0.119	0.066	2.268	1041	0.078	0.034	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
20	PDB:7r04A	0.123	0.034	2.268	2326	0.053	0.010	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NZT2	1.55e-84	275	677	0.259	0.173	OGFR_HUMAN Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3
2	P23470	0.38	35.8	1445	0.044	0.014	PTPRG_HUMAN Receptor-type tyrosine-protein phosphatase gamma OS=Homo sapiens OX=9606 GN=PTPRG PE=1 SV=4
3	M9PDR2	1.8	33.5	1256	0.062	0.022	M9PDR2_DROME Homeodomain interacting protein kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
4	Q5SUG2	2.0	33.5	2176	0.040	0.008	Q5SUG2_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
5	A0A6M3Q6U2	2.1	33.5	1409	0.062	0.020	A0A6M3Q6U2_DROME Homeodomain interacting protein kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=1
6	Q27YN9	2.1	33.5	2265	0.040	0.008	Q27YN9_MOUSE T-type calcium channel alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
7	Q5SUF5	2.1	33.5	2247	0.040	0.008	Q5SUF5_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
8	E9PWL1	2.2	33.5	2272	0.040	0.008	E9PWL1_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
9	Q5SUF6	2.2	33.5	2288	0.040	0.008	Q5SUF6_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
10	Q5SUF7	2.2	33.5	2381	0.040	0.008	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
11	Q5SUF8	2.2	33.5	2254	0.040	0.008	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
12	Q5SUF9	2.2	33.5	2265	0.040	0.008	Q5SUF9_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
13	Q5SUG0	2.2	33.5	2277	0.040	0.008	Q5SUG0_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
14	Q5SUG1	2.2	33.5	2248	0.040	0.008	Q5SUG1_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
15	Q5SUG3	2.2	33.5	2270	0.040	0.008	Q5SUG3_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
16	Q5SUG4	2.2	33.5	2295	0.040	0.008	Q5SUG4_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q6PFV8	2.2	33.5	2248	0.040	0.008	Q6PFV8_MOUSE Cacna1g protein OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
18	Q9WUT2	2.2	33.5	2295	0.040	0.008	Q9WUT2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
19	Q9W0Q1	2.3	33.5	1340	0.062	0.021	Q9W0Q1_DROME Homeodomain interacting protein kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Hipk PE=4 SV=2
20	Q7L5N7	2.4	33.1	544	0.040	0.033	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19915 bpX0	2.7e+02	13.2	MoxR-vWA-beta-propeller ternary system domain bpX0
2	PF04664 OGFr_N	2.3e-97	336.0	Opioid growth factor receptor (OGFr) conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356468	0.717	Influenza virus NS1A-binding protein
2	9606.ENSP00000336842	0.617	Actin-related protein 8
3	9606.ENSP00000366032	0.616	COMM domain-containing protein 3
4	9606.ENSP00000367552	0.615	RCC1 and BTB domain-containing protein 1
5	9606.ENSP00000009041	0.610	STARD3 N-terminal-like protein
6	9606.ENSP00000364008	0.604	Lipid phosphate phosphatase-related protein type 1
7	9606.ENSP00000429367	0.582	Protein FAM92A
8	9606.ENSP00000479281	0.560	Uncharacterized protein LOC400658
9	9606.ENSP00000263026	0.556	Eukaryotic elongation factor 2 kinase
10	9606.ENSP00000299320	0.556	Uncharacterized protein C16orf71
11	9606.ENSP00000370593	0.528	Receptor-type tyrosine-protein phosphatase delta
12	9606.ENSP00000434727	0.514	Coiled-coil domain containing 180
13	9606.ENSP00000258526	0.510	Plexin-C1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.689	organic cyclic compound binding
GO:1901363	0.471	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.982	cellular process
GO:0050794	0.933	regulation of cellular process
GO:0019222	0.932	regulation of metabolic process
GO:0060255	0.924	regulation of macromolecule metabolic process
GO:0048518	0.756	positive regulation of biological process
GO:0031323	0.743	regulation of cellular metabolic process
GO:0051171	0.727	regulation of nitrogen compound metabolic process
GO:0048519	0.706	negative regulation of biological process
GO:0010468	0.696	regulation of gene expression
GO:0080090	0.684	regulation of primary metabolic process
GO:0009893	0.585	positive regulation of metabolic process
GO:0019219	0.582	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.559	positive regulation of cellular process
GO:0050896	0.499	response to stimulus
GO:0010604	0.465	positive regulation of macromolecule metabolic process
GO:0071704	0.378	organic substance metabolic process
GO:0044238	0.330	primary metabolic process
GO:0006807	0.312	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0070013	0.990	intracellular organelle lumen
GO:0005634	0.990	nucleus
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0016020	0.972	membrane
GO:0005737	0.966	cytoplasm
GO:0031981	0.778	nuclear lumen
GO:0012505	0.667	endomembrane system
GO:0005654	0.588	nucleoplasm
GO:0005886	0.587	plasma membrane
GO:0005694	0.415	chromosome
GO:0005829	0.319	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]