StarFunc result for job id Q5TCH4

User Input

>input (519 residues)
MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLF
GHIQEFQHDQELQRIQERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGRSDPKSHGSY
KFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQD
SPLEVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHEND
TIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILLLAKM
ENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGAS
ITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH
NPKVWPNLEVFDPSRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL
LPDPTRIPIPMARLVLKSKNGIHLRLRRLPNPCEDKDQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02928	0.970	0.970	3.232E-71	519	0.946	0.946	Q02928.pdb.gz	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
2	AFDB:A2A974	0.950	0.970	5.544E-65	508	0.738	0.754	A2A974.pdb.gz	CP4CB_MOUSE Cytochrome P450 4A12B OS=Mus musculus OX=10090 GN=Cyp4a12b PE=1 SV=1
3	AFDB:P24464	0.960	0.981	1.202E-63	508	0.728	0.744	P24464.pdb.gz	CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus OX=10116 GN=Cyp4a12 PE=1 SV=2
4	AFDB:O88833	0.947	0.965	1.021E-62	509	0.736	0.750	O88833.pdb.gz	CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus OX=10090 GN=Cyp4a10 PE=1 SV=2
5	AFDB:P20817	0.936	0.958	7.491E-60	507	0.696	0.712	P20817.pdb.gz	CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus OX=10116 GN=Cyp4a14 PE=1 SV=2
6	AFDB:P15129	0.911	0.924	3.242E-48	511	0.499	0.507	P15129.pdb.gz	CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus OX=10116 GN=Cyp4b1 PE=1 SV=3
7	AFDB:Q86W10	0.910	0.934	3.874E-48	505	0.486	0.499	Q86W10.pdb.gz	CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens OX=9606 GN=CYP4Z1 PE=1 SV=1
8	AFDB:P13584	0.909	0.923	4.115E-47	511	0.499	0.507	P13584.pdb.gz	CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens OX=9606 GN=CYP4B1 PE=1 SV=2
9	AFDB:Q8N118	0.909	0.926	1.294E-44	509	0.461	0.470	Q8N118.pdb.gz	CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens OX=9606 GN=CYP4X1 PE=1 SV=1
10	AFDB:Q08477	0.871	0.869	1.338E-39	520	0.435	0.435	Q08477.pdb.gz	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
11	PDB:5veuC	0.766	0.842	1.384E-22	469	0.227	0.252	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
12	PDB:7mk8B	0.734	0.811	3.375E-22	465	0.227	0.254	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
13	PDB:5te8B	0.736	0.805	1.125E-21	471	0.224	0.246	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
14	PDB:2j0dB	0.685	0.790	3.428E-21	445	0.222	0.258	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
15	PDB:5veuL	0.727	0.835	1.306E-20	448	0.212	0.246	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
16	PDB:3k9vA	0.757	0.841	2.331E-20	464	0.191	0.213	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
17	PDB:7n3mAAA	0.719	0.847	8.881E-20	437	0.193	0.229	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
18	PDB:7kvjA	0.650	0.804	9.709E-20	415	0.210	0.263	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.
19	PDB:6cizC	0.705	0.762	2.707E-19	477	0.175	0.191	6cizC.pdb.gz	Structure-Based Design of Inhibitors with Improved Selectivity for Steroidogenic Cytochrome P450 17A1 over Cytochrome P450 21A2.
20	PDB:7cb9A	0.771	0.853	2.959E-19	466	0.160	0.178	7cb9A.pdb.gz	CYP76AH1 from Salvia miltiorrhiza

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A974	0.0	778	508	0.738	0.754	CP4CB_MOUSE Cytochrome P450 4A12B OS=Mus musculus OX=10090 GN=Cyp4a12b PE=1 SV=1
2	O88833	0.0	795	509	0.736	0.750	CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus OX=10090 GN=Cyp4a10 PE=1 SV=2
3	P08516	0.0	791	509	0.734	0.749	CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus OX=10116 GN=Cyp4a10 PE=1 SV=2
4	P20816	0.0	748	504	0.694	0.714	CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus OX=10116 GN=Cyp4a2 PE=1 SV=2
5	P20817	0.0	759	507	0.696	0.712	CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus OX=10116 GN=Cyp4a14 PE=1 SV=2
6	P24464	0.0	787	508	0.728	0.744	CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus OX=10116 GN=Cyp4a12 PE=1 SV=2
7	Q02928	0.0	974	519	0.948	0.948	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
8	Q5TCH4	0.0	1074	519	1.000	1.000	CP4AM_HUMAN Cytochrome P450 4A22 OS=Homo sapiens OX=9606 GN=CYP4A22 PE=1 SV=1
9	Q91WL5	0.0	774	508	0.732	0.748	CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus OX=10090 GN=Cyp4a12a PE=1 SV=2
10	P15129	1.04e-179	516	511	0.505	0.513	CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus OX=10116 GN=Cyp4b1 PE=1 SV=3
11	Q86W10	4.24e-176	507	505	0.476	0.489	CP4Z1_HUMAN Cytochrome P450 4Z1 OS=Homo sapiens OX=9606 GN=CYP4Z1 PE=1 SV=1
12	P13584	3.79e-173	499	511	0.491	0.499	CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens OX=9606 GN=CYP4B1 PE=1 SV=2
13	Q8N118	1.08e-164	478	509	0.441	0.450	CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens OX=9606 GN=CYP4X1 PE=1 SV=1
14	P51869	6.39e-137	408	522	0.432	0.429	CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus OX=10116 GN=Cyp4f4 PE=1 SV=1
15	Q08477	1.63e-136	407	520	0.424	0.423	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
16	P33274	1.65e-135	404	524	0.435	0.431	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
17	Q99N16	3.96e-135	403	524	0.426	0.422	CP4F3_MOUSE Cytochrome P450 4F3 OS=Mus musculus OX=10090 GN=Cyp4f3 PE=1 SV=2
18	P78329	4.72e-135	403	520	0.441	0.440	CP4F2_HUMAN Cytochrome P450 4F2 OS=Homo sapiens OX=9606 GN=CYP4F2 PE=1 SV=1
19	P98187	2.96e-132	395	520	0.428	0.427	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
20	Q6NT55	2.17e-129	389	531	0.408	0.399	CP4FN_HUMAN Ultra-long-chain fatty acid omega-hydroxylase OS=Homo sapiens OX=9606 GN=CYP4F22 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	1.9e-121	417.7	Cytochrome P450
2	PF00361 Proton_antipo_M	5.2e+02	11.2	Proton-conducting membrane transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360958

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360247	0.954	Cytochrome P450 2J2
2	9606.ENSP00000360317	0.952	Cytochrome P450 2C8
3	9606.ENSP00000260682	0.951	Cytochrome P450 2C9
4	9606.ENSP00000301141	0.951	Cytochrome P450 2A6
5	9606.ENSP00000324648	0.950	Cytochrome P450 2B6
6	9606.ENSP00000360372	0.949	Cytochrome P450 2C19
7	9606.ENSP00000333212	0.948	Cytochrome P450 2U1
8	9606.ENSP00000440689	0.948	Cytochrome P450 2E1
9	9606.ENSP00000369050	0.947	Cytochrome P450 1A1
10	9606.ENSP00000222982	0.946	Cytochrome P450 3A5
11	9606.ENSP00000337915	0.945	Cytochrome P450 3A4
12	9606.ENSP00000480571	0.945	Cytochrome P450 3A7
13	9606.ENSP00000342007	0.942	Cytochrome P450 1A2
14	9606.ENSP00000308032	0.931	Cytochrome P450 2S1
15	9606.ENSP00000224356	0.929	Cytochrome P450 26A1
16	9606.ENSP00000311095	0.928	Cytochrome P450 4A11
17	9606.ENSP00000221700	0.927	Phylloquinone omega-hydroxylase CYP4F2
18	9606.ENSP00000285949	0.927	Cytochrome P450 26C1
19	9606.ENSP00000221307	0.926	Docosahexaenoic acid omega-hydroxylase CYP4F3
20	9606.ENSP00000001146	0.925	Cytochrome P450 26B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0016713	0.782	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen
GO:0008391	0.708	arachidonic acid monooxygenase activity
GO:0005488	0.703	binding
GO:0008395	0.557	steroid hydroxylase activity
GO:0016709	0.438	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005515	0.408	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.998	cellular lipid metabolic process
GO:0044281	0.968	small molecule metabolic process
GO:0032787	0.877	monocarboxylic acid metabolic process
GO:0006631	0.718	fatty acid metabolic process
GO:0065007	0.467	biological regulation
GO:0120254	0.450	olefinic compound metabolic process
GO:0006690	0.447	icosanoid metabolic process
GO:0001676	0.427	long-chain fatty acid metabolic process
GO:0050896	0.425	response to stimulus
GO:0033559	0.341	unsaturated fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0016020	0.983	membrane
GO:0005737	0.977	cytoplasm
GO:0005886	0.956	plasma membrane
GO:0005576	0.955	extracellular region
GO:0005789	0.918	endoplasmic reticulum membrane
GO:0005615	0.796	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.15.-	0.782	With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen.
RHEA:43836	0.557	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.13.-	0.438	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]