StarFunc result for job id Q5TCQ9

User Input

>input (1481 residues)
MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDAESQRKRTTSVSKMERMDSSLPEEE
EDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDETLEPLPKNWE
MAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQVEIGSSKPDMEKSHFTRDPSQLKGVLVRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQ
NGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFISTQNGSPRLNRAEV
PARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVG
DHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRP
MGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCY
PVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGIT
HTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPLPPSSHFASIF
EESHVPVIEESLRVQICEKAEELKDIVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSH
GHSNKKNLLKVENGVTRRGRSVSPKKPASQHSEEHLDKIPSPLKNNPKRRPRDQSLSPSK
GENKSCQVSTRAGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAEAKLLEGKSRRIAGYT
GSNAEQIPDGKEKSDVIRKDAKQNQLEKSRTRSPEKKIKRMVEKSLPSKMTNKTTSKEVS
ENEKGKKVTTGETSSSNDKIGENVQLSEKRLKQEPEEKVVSNKTEDHKGKELEAADKNKE
TGRFKPESSSPVKKTLITPGPWKVPSGNKVTGTIGMAEKRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QIL2	0.435	0.558	0.000	1114	0.471	0.626	E9QIL2.pdb.gz
2	AFDB:F1NMZ1	0.181	0.206	0.000	1256	0.362	0.427	F1NMZ1.pdb.gz
3	AFDB:F1Q897	0.290	0.287	0.000	1503	0.418	0.412	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
4	AFDB:Q5F488	0.381	0.467	0.000	1128	0.639	0.839	Q5F488.pdb.gz	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
5	AFDB:Q5TCQ9	1.000	1.000	0.000	1481	1.000	1.000	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
6	AFDB:Q5VSD9	0.155	0.178	0.000	1274	0.390	0.454	Q5VSD9.pdb.gz
7	AFDB:Q6RHR9	0.157	0.158	0.000	1471	0.387	0.390	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
8	AFDB:Q86UL8	0.283	0.288	0.000	1455	0.442	0.449	Q86UL8.pdb.gz	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
9	AFDB:Q96QZ7	0.140	0.139	0.000	1491	0.387	0.384	Q96QZ7.pdb.gz	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
10	AFDB:Q9EQJ9	0.553	0.554	0.000	1476	0.864	0.867	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
11	PDB:2xkxA	0.061	0.122	1.930E-17	721	0.067	0.137	2xkxA.pdb.gz
12	PDB:5n7dA	0.070	0.241	2.550E-13	423	0.042	0.147	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
13	PDB:7p73A	0.057	0.197	5.990E-7	420	0.020	0.069	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7pc3A	0.054	0.190	1.285E-6	405	0.021	0.077	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:6pcvA	0.058	0.105	2.758E-6	754	0.026	0.052	6pcvA.pdb.gz
16	PDB:7p70A	0.055	0.198	5.917E-6	407	0.016	0.059	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:6t36A	0.055	0.821	1.078E-5	93	0.017	0.269	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:7qqmA	0.055	0.193	1.341E-5	413	0.019	0.068	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7qqnC	0.053	0.186	1.341E-5	414	0.014	0.051	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.054	0.187	2.877E-5	415	0.019	0.067	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WT53	0.0	691	1155	0.265	0.339	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
2	A0A087WXD2	0.0	676	980	0.265	0.401	A0A087WXD2_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
3	A0A8I3NPD4	0.0	858	1398	0.327	0.346	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
4	F1Q897	0.0	877	1503	0.344	0.339	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
5	H7C4U7	0.0	784	1131	0.311	0.408	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
6	H7C535	0.0	784	1136	0.311	0.406	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	H7C5T8	0.0	719	1014	0.285	0.416	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
8	O88382	0.0	1090	1277	0.417	0.484	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
9	Q5F488	0.0	1915	1128	0.635	0.834	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
10	Q5TCQ9	0.0	3046	1481	1.000	1.000	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
11	Q6RHR9	0.0	923	1471	0.370	0.373	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
12	Q86UL8	0.0	1087	1455	0.417	0.424	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
13	Q96QZ7	0.0	918	1491	0.360	0.357	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
14	Q9EQJ9	0.0	2522	1476	0.865	0.868	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
15	Q9JK71	0.0	2531	1470	0.861	0.867	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
16	Q9WVQ1	0.0	1092	1275	0.419	0.487	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
17	C6KRJ8	7.02e-103	350	802	0.196	0.362	C6KRJ8_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
18	C1P634	1.29e-102	350	855	0.196	0.339	C1P634_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
19	C1P633	2.04e-100	349	1054	0.195	0.274	C1P633_CAEEL MAGI (Membrane Associated Guanylate kinase Inverted) homolog OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
20	D3YT29	5.01e-92	320	829	0.164	0.293	D3YT29_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05627 AvrRpt-cleavage	3.5e+02	11.9	Cleavage site for pathogenic type III effector avirulence factor Avr
2	PF19805 DUF6288	0.00017	32.5	Family of unknown function (DUF6288)
3	PF00625 Guanylate_kin	1.1e-07	43.2	Guanylate kinase
4	PF16663 MAGI_u1	0.002	29.3	Unstructured region on MAGI
5	PF00595 PDZ	2.5e-63	221.7	PDZ domain
6	PF13180 PDZ_2	1.7e-23	94.1	PDZ domain
7	PF17820 PDZ_6	2.8e-41	150.5	PDZ domain
8	PF02163 Peptidase_M50	7.4e-10	50.2	Peptidase family M50
9	PF14685 Tricorn_PDZ	0.019	26.2	Tricorn protease PDZ domain
10	PF00397 WW	2.3e-13	61.3	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304604

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.969	Catenin beta-1
2	9606.ENSP00000361021	0.965	Phosphatase and tensin homolog
3	9606.ENSP00000434034	0.939	Frizzled-4
4	9606.ENSP00000358301	0.893	Beta-1 adrenergic receptor
5	9606.ENSP00000357040	0.882	Vang-like protein 2
6	9606.ENSP00000390590	0.871	Dendrin
7	9606.ENSP00000264431	0.851	Rap guanine nucleotide exchange factor 2
8	9606.ENSP00000385450	0.828	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
9	9606.ENSP00000346151	0.820	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
10	9606.ENSP00000305372	0.815	Beta-2 adrenergic receptor
11	9606.ENSP00000296859	0.814	Rap guanine nucleotide exchange factor 6
12	9606.ENSP00000262811	0.769	Microtubule associated serine/threonine kinase 3
13	9606.ENSP00000444628	0.689	Beta-galactosidase-1-like protein 2
14	9606.ENSP00000346155	0.680	Uridine-cytidine kinase-like 1
15	9606.ENSP00000356853	0.680	Uridine-cytidine kinase 2
16	9606.ENSP00000361285	0.680	Uridine-cytidine kinase 1
17	9606.ENSP00000377508	0.680	Junction plakoglobin
18	9606.ENSP00000329213	0.675	Apoptosis regulatory protein Siva
19	9606.ENSP00000371341	0.635	Activated CDC42 kinase 1
20	9606.ENSP00000443256	0.635	Lysophosphatidic acid receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.520	enzyme binding
GO:0005102	0.422	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.955	positive regulation of biological process
GO:0048522	0.927	positive regulation of cellular process
GO:0009987	0.902	cellular process
GO:0019222	0.830	regulation of metabolic process
GO:0060255	0.785	regulation of macromolecule metabolic process
GO:0031323	0.782	regulation of cellular metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0051171	0.772	regulation of nitrogen compound metabolic process
GO:0051174	0.766	regulation of phosphorus metabolic process
GO:0051246	0.735	regulation of protein metabolic process
GO:0031399	0.717	regulation of protein modification process
GO:0065009	0.697	regulation of molecular function
GO:0023051	0.568	regulation of signaling
GO:0009893	0.529	positive regulation of metabolic process
GO:0050790	0.518	regulation of catalytic activity
GO:0050896	0.517	response to stimulus
GO:0010646	0.468	regulation of cell communication
GO:0048583	0.454	regulation of response to stimulus
GO:0019220	0.450	regulation of phosphate metabolic process
GO:0071704	0.436	organic substance metabolic process
GO:0051173	0.435	positive regulation of nitrogen compound metabolic process
GO:0044238	0.423	primary metabolic process
GO:1902531	0.390	regulation of intracellular signal transduction
GO:0006807	0.368	nitrogen compound metabolic process
GO:0051716	0.364	cellular response to stimulus
GO:0007154	0.349	cell communication
GO:0042325	0.345	regulation of phosphorylation
GO:0001932	0.342	regulation of protein phosphorylation
GO:0071840	0.341	cellular component organization or biogenesis
GO:0023052	0.328	signaling
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0007165	0.320	signal transduction
GO:0048523	0.318	negative regulation of cellular process
GO:0031325	0.313	positive regulation of cellular metabolic process
GO:0016043	0.311	cellular component organization
GO:0051338	0.308	regulation of transferase activity
GO:0044093	0.305	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005622	0.997	intracellular anatomical structure
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.992	intracellular organelle
GO:0005634	0.980	nucleus
GO:0005737	0.978	cytoplasm
GO:0071944	0.925	cell periphery
GO:0005886	0.902	plasma membrane
GO:0005829	0.707	cytosol
GO:0070161	0.629	anchoring junction
GO:0005911	0.411	cell-cell junction
GO:0031974	0.345	membrane-enclosed lumen
GO:0070013	0.343	intracellular organelle lumen
GO:0031981	0.318	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]