StarFunc result for job id Q5TCX8

User Input

>input (1036 residues)
MALRGAAGATDTPVSSAGGAPGGSASSSSTSSGGSASAGAGLWAALYDYEARGEDELSLR
RGQLVEVLSQDAAVSGDEGWWAGQVQRRLGIFPANYVAPCRPAASPAPPPSRPSSPVHVA
FERLELKELIGAGGFGQVYRATWQGQEVAVKAARQDPEQDAAAAAESVRREARLFAMLRH
PNIIELRGVCLQQPHLCLVLEFARGGALNRALAAANAAPDPRAPGPRRARRIPPHVLVNW
AVQIARGMLYLHEEAFVPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREWHRTT
KMSTAGTYAWMAPEVIKSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNK
LTLPIPSTCPEPFAKLMKECWQQDPHIRPSFALILEQLTAIEGAVMTEMPQESFHSMQDD
WKLEIQQMFDELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAEREIDVLERELN
ILIFQLNQEKPKVKKRKGKFKRSRLKLKDGHRISLPSDFQHKITVQASPNLDKRRSLNSS
SSSPPSSPTMMPRLRAIQLTSDESNKTWGRNTVFRQEEFEDVKRNFKKKGCTWGPNSIQM
KDRTDCKERIRPLSDGNSPWSTILIKNQKTMPLASLFVDQPGSCEEPKLSPDGLEHRKPK
QIKLPSQAYIDLPLGKDAQRENPAEAESWEEAASANAATVSIEMTPTNSLSRSPQRKKTE
SALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKSRRSASPPTSL
PSTCGEASSPPSLPLSSALGILSTPSFSTKCLLQMDSEDPLVDSAPVTCDSEMLTPDFCP
TAPGSGREPALMPRLDTDCSVSRNLPSSFLQQTCGNVPYCASSKHRPSHHRRTMSDGNPT
PTGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAY
PQTAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRS
KTSRPSIYELEKEFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TCX8	1.000	1.000	0.000	1036	1.000	1.000	Q5TCX8.pdb.gz	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
2	AFDB:P80192	0.416	0.393	1.879E-81	1104	0.505	0.474	P80192.pdb.gz	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
3	AFDB:A0A0G2JUN9	0.399	0.385	3.419E-77	1077	0.504	0.485	A0A0G2JUN9.pdb.gz	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
4	AFDB:Q95UN8	0.343	0.308	5.272E-53	1161	0.310	0.276	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
5	AFDB:A0A0K3AV08	0.267	0.261	7.543E-32	1059	0.202	0.197	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
6	AFDB:F7BN18	0.237	0.219	5.913E-24	1128	0.212	0.195	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
7	AFDB:E9PT20	0.236	0.216	6.249E-24	1143	0.205	0.185	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
8	AFDB:A0A024R8E2	0.242	0.224	6.982E-24	1130	0.200	0.183	A0A024R8E2.pdb.gz
9	AFDB:P42684	0.238	0.211	2.423E-22	1182	0.211	0.185	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
10	PDB:2h8hA	0.232	0.513	5.690E-21	445	0.113	0.263	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
11	PDB:1k9aB	0.230	0.525	5.222E-20	441	0.101	0.238	1k9aB.pdb.gz
12	PDB:4fl2A	0.234	0.422	2.024E-18	555	0.086	0.160	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.229	0.420	2.823E-18	551	0.093	0.174	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:4btfA	0.220	0.510	8.768E-17	413	0.064	0.160	4btfA.pdb.gz
15	AFDB:Q23977	0.235	0.209	8.790E-17	1178	0.188	0.166	Q23977.pdb.gz	HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster OX=7227 GN=hep PE=1 SV=2
16	PDB:7mfdA	0.231	0.556	3.137E-16	410	0.090	0.227	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
17	PDB:6s73A	0.228	0.809	4.138E-16	269	0.069	0.268	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:6lk5A	0.222	0.781	6.099E-16	265	0.066	0.257	6lk5A.pdb.gz
19	PDB:2qkwB	0.218	0.684	7.384E-15	292	0.078	0.277	2qkwB.pdb.gz
20	PDB:4rgjA	0.227	0.478	1.216E-14	463	0.075	0.168	4rgjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUN9	0.0	912	1078	0.522	0.502	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
2	D3ZG83	0.0	762	940	0.467	0.515	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
3	F1LRA7	0.0	903	1100	0.522	0.492	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
4	P80192	0.0	889	1104	0.517	0.486	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
5	Q02779	0.0	765	954	0.463	0.503	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
6	Q16584	0.0	699	847	0.344	0.420	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
7	Q5TCX8	0.0	2123	1036	1.000	1.000	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
8	Q66HA1	0.0	702	850	0.344	0.419	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
9	Q66L42	0.0	759	940	0.463	0.511	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
10	Q7T2V3	0.0	855	1005	0.478	0.493	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
11	Q80XI6	0.0	704	850	0.344	0.419	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
12	Q95UN8	1.97e-162	511	1161	0.262	0.233	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
13	Q12852	3.28e-71	256	859	0.139	0.168	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
14	Q60700	6.96e-71	256	888	0.139	0.162	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
15	Q1HKZ5	5.63e-68	248	959	0.152	0.164	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
16	O43283	1.95e-67	247	966	0.139	0.149	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
17	D4Q8H0	1.91e-66	233	455	0.131	0.299	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
18	Q9ESL4	2.49e-64	235	802	0.130	0.168	M3K20_MOUSE Mitogen-activated protein kinase kinase kinase 20 OS=Mus musculus OX=10090 GN=Map3k20 PE=1 SV=1
19	Q9NYL2	2.85e-64	235	800	0.130	0.169	M3K20_HUMAN Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3
20	D3DMF6	8.96e-63	233	950	0.133	0.145	D3DMF6_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.024	25.3	ABC1 atypical kinase-like domain
2	PF00069 Pkinase	2.1e-55	199.5	Protein kinase domain
3	PF17667 Pkinase_fungal	3.9	17.8	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1.3e-60	216.4	Protein tyrosine and serine/threonine kinase
5	PF00018 SH3_1	1.9e-07	41.9	SH3 domain
6	PF07653 SH3_2	1.3e-06	39.4	Variant SH3 domain
7	PF14604 SH3_9	1.2e-09	49.3	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355583

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.589	Cell division control protein 42 homolog
2	9606.ENSP00000357196	0.566	Receptor-type tyrosine-protein phosphatase kappa
3	9606.ENSP00000276659	0.524	R-spondin-2
4	9606.ENSP00000363089	0.504	Toll-like receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.997	catalytic activity, acting on a protein
GO:0016773	0.996	phosphotransferase activity, alcohol group as acceptor
GO:0016301	0.996	kinase activity
GO:0004672	0.992	protein kinase activity
GO:0004674	0.503	protein serine/threonine kinase activity
GO:0019899	0.380	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048522	0.979	positive regulation of cellular process
GO:0008152	0.943	metabolic process
GO:0071704	0.921	organic substance metabolic process
GO:0019222	0.800	regulation of metabolic process
GO:0031323	0.793	regulation of cellular metabolic process
GO:0044238	0.770	primary metabolic process
GO:0043412	0.752	macromolecule modification
GO:0006807	0.742	nitrogen compound metabolic process
GO:0050896	0.723	response to stimulus
GO:1901564	0.688	organonitrogen compound metabolic process
GO:0044237	0.672	cellular metabolic process
GO:0051716	0.651	cellular response to stimulus
GO:0007165	0.610	signal transduction
GO:0048583	0.596	regulation of response to stimulus
GO:0051171	0.580	regulation of nitrogen compound metabolic process
GO:0036211	0.576	protein modification process
GO:0060255	0.567	regulation of macromolecule metabolic process
GO:0080090	0.565	regulation of primary metabolic process
GO:0008219	0.493	cell death
GO:0006468	0.493	protein phosphorylation
GO:0009966	0.437	regulation of signal transduction
GO:0010941	0.421	regulation of cell death
GO:0006950	0.409	response to stress
GO:0048584	0.402	positive regulation of response to stimulus
GO:1902531	0.395	regulation of intracellular signal transduction
GO:0032502	0.372	developmental process
GO:0035556	0.354	intracellular signal transduction
GO:0033554	0.342	cellular response to stress
GO:0065009	0.339	regulation of molecular function
GO:0048856	0.334	anatomical structure development
GO:0032501	0.320	multicellular organismal process
GO:0010604	0.314	positive regulation of macromolecule metabolic process
GO:1902533	0.312	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.838	cytosol
GO:0043229	0.501	intracellular organelle
GO:0043231	0.425	intracellular membrane-bounded organelle
GO:0016020	0.377	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.

[back to server]