StarFunc result for job id Q5TCY1

User Input

>input (1321 residues)
MQCLAAALKDETNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENV
ALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRS
QPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLA
RQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWR
KIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKER
GIAENEAFDWEKAGTDALLSTSTSTPPQQNTRQTAAMFGVVNVTPVPGDLLRENTEDVLQ
GEHLSDQENAPPILPGRPSEGLGPSPHLVPHPGGPEAEVWEETDVNRNKLRINIGKSPCV
EEEQSRGMGVPSSPVRAPPDSPTTPVRSLRYRRVNSPESERLSTADGRVELPERRSRMDL
PGSPSRQACSSQPAQMLSVDTGHADRQASGRMDVSASVEQEALSNAFRSVPLAEEEDFDS
KEWVIIDKETELKDFPPGAEPSTSGTTDEEPEELRPLPEEGEERRRLGAEPTVRPRGRSM
QALAEEDLQHLPPQPLPPQLSQGDGRSETSQPPTPGSPSHSPLHSGPRPRRRESDPTGPQ
RQVFSVAPPFEVNGLPRAVPLSLPYQDFKRDLSDYRERARLLNRVRRVGFSHMLLTTPQV
PLAPVQPQANGKEEEEEEEEDEEEEEEDEEEEEEEEEEEEEEEEEEEEEEEAAAAVALGE
VLGPRSGSSSEGSERSTDRSQEGAPSTLLADDQKESRGRASMADGDLEPEEGSKTLVLVS
PGDMKKSPVTAELAPDPDLGTLAALTPQHERPQPTGSQLDVSEPGTLSSVLKSEPKPPGP
GAGLGAGTVTTGVGGVAVTSSPFTKVERTFVHIAEKTHLNVMSSGGQALRSEEFSAGGEL
GLELASDGGAVEEGARAPLENGLALSGLNGAEIEGSALSGAPRETPSEMATNSLPNGPAL
ADGPAPVSPLEPSPEKVATISPRRHAMPGSRPRSRIPVLLSEEDTGSEPSGSLSAKERWS
KRARPQQDLARLVMEKRQGRLLLRLASGASSSSSEEQRRASETLSGTGSEEDTPASEPAA
ALPRKSGRAAATRSRIPRPIGLRMPMPVAAQQPASRSHGAAPALDTAITSRLQLQTPPGS
ATAADLRPKQPPGRGLGPGRAQAGARPPAPRSPRLPASTSAARNASASPRSQSLSRRESP
SPSHQARPGVPPPRGVPPARAQPDGTPSPGGSKKGPRGKLQAQRATTKGRAGGAEGRAGA
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TCY1	0.999	0.999	0.000	1321	1.000	1.000	Q5TCY1.pdb.gz	TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TTBK1 PE=1 SV=2
2	AFDB:Q3UVR3	0.232	0.247	1.266E-64	1243	0.375	0.398	Q3UVR3.pdb.gz	TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1
3	AFDB:Q6IQ55	0.244	0.259	8.163E-63	1244	0.375	0.398	Q6IQ55.pdb.gz	TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TTBK2 PE=1 SV=2
4	AFDB:L0MLK2	0.227	0.262	5.534E-52	1144	0.239	0.276	L0MLK2.pdb.gz	L0MLK2_DROME Asator, isoform G OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
5	AFDB:Q8IMC6	0.229	0.239	2.896E-51	1262	0.254	0.266	Q8IMC6.pdb.gz	ASATR_DROME Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2
6	PDB:6gzdA	0.214	0.923	1.548E-27	297	0.077	0.343	6gzdA.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
7	PDB:6pxnA	0.206	0.902	1.607E-26	290	0.082	0.372	6pxnA.pdb.gz
8	AFDB:Q9W532	0.158	0.149	6.652E-18	1398	0.153	0.144	Q9W532.pdb.gz	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
9	AFDB:Q9W002	0.180	0.159	4.374E-17	1504	0.157	0.138	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
10	AFDB:O88904	0.179	0.193	4.807E-16	1210	0.140	0.153	O88904.pdb.gz	HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus OX=10090 GN=Hipk1 PE=1 SV=2
11	AFDB:A1ZBC4	0.148	0.134	7.167E-16	1471	0.165	0.148	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
12	AFDB:Q6P4S6	0.168	0.169	9.534E-16	1311	0.158	0.159	Q6P4S6.pdb.gz	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
13	PDB:5u6yA	0.173	0.458	2.714E-15	459	0.048	0.139	5u6yA.pdb.gz
14	PDB:4krcA	0.179	0.716	3.221E-15	297	0.042	0.185	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
15	PDB:2rsvA	0.199	0.596	5.700E-15	403	0.064	0.211	2rsvA.pdb.gz
16	PDB:6b1uA	0.179	0.508	3.968E-14	442	0.045	0.136	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4eomC	0.181	0.788	5.278E-14	276	0.040	0.192	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	PDB:1unlA	0.163	0.643	8.333E-14	292	0.043	0.195	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:6qx9K	0.160	0.617	1.242E-13	322	0.035	0.143	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:5oniA	0.176	0.630	1.315E-13	334	0.046	0.183	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTK1	0.0	2176	1307	0.881	0.891	A0A0G2JTK1_RAT Tau tubulin kinase 1 OS=Rattus norvegicus OX=10116 GN=Ttbk1 PE=1 SV=2
2	A0A0G2JYZ1	0.0	671	1242	0.291	0.310	A0A0G2JYZ1_RAT Tau tubulin kinase 2 OS=Rattus norvegicus OX=10116 GN=Ttbk2 PE=1 SV=1
3	Q3UVR3	0.0	671	1243	0.289	0.307	TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1
4	Q5TCY1	0.0	2640	1321	1.000	1.000	TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens OX=9606 GN=TTBK1 PE=1 SV=2
5	Q6IQ55	0.0	682	1244	0.273	0.289	TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens OX=9606 GN=TTBK2 PE=1 SV=2
6	Q6PCN3	0.0	2188	1308	0.896	0.904	TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=Ttbk1 PE=1 SV=3
7	L0MLN1	5.91e-157	503	1106	0.168	0.201	L0MLN1_DROME Asator, isoform K OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
8	L0MLK2	1.16e-156	503	1144	0.168	0.194	L0MLK2_DROME Asator, isoform G OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
9	L0MPN7	2.13e-156	504	1193	0.168	0.186	L0MPN7_DROME Asator, isoform H OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
10	L0MN72	1.05e-155	504	1261	0.168	0.176	L0MN72_DROME Asator, isoform J OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
11	Q8IMC6	1.88e-155	503	1262	0.168	0.176	ASATR_DROME Tau-tubulin kinase homolog Asator OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=2
12	L0MPX5	3.90e-155	504	1348	0.168	0.165	L0MPX5_DROME Asator, isoform I OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=1
13	Q9V4D6	5.47e-155	504	1349	0.168	0.165	Q9V4D6_DROME Asator, isoform D OS=Drosophila melanogaster OX=7227 GN=Asator PE=1 SV=3
14	Q8IWY7	2.93e-121	416	1649	0.136	0.109	Q8IWY7_HUMAN Tau-tubulin kinase OS=Homo sapiens OX=9606 PE=1 SV=1
15	Q5BP74	4.06e-51	188	415	0.083	0.263	KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis OX=8355 GN=csnk1d PE=1 SV=2
16	Q06486	7.60e-51	187	415	0.083	0.263	KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus OX=10116 GN=Csnk1d PE=1 SV=2
17	Q9DC28	7.60e-51	187	415	0.083	0.263	KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus OX=10090 GN=Csnk1d PE=1 SV=2
18	P35508	7.90e-51	187	415	0.083	0.263	KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus OX=9913 GN=CSNK1D PE=2 SV=2
19	P48730	7.90e-51	187	415	0.083	0.263	KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D PE=1 SV=2
20	Q99PS2	1.43e-50	189	506	0.081	0.211	Q99PS2_RAT Casein kinase 1, epsilon OS=Rattus norvegicus OX=10116 GN=Csnk1e PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05432 BSP_II	17	16.6	Bone sialoprotein II (BSP-II)
2	PF00029 Connexin	4.1e+02	12.1	Connexin
3	PF13299 CPSF100_C	7e+02	11.8	Cleavage and polyadenylation factor 2 C-terminal
4	PF16091 DUF4820	3.5e+02	11.9	Domain of unknown function (DUF4820)
5	PF04006 Mpp10	29	14.9	Mpp10 protein
6	PF04147 Nop14	1.2e+02	12.4	Nop14-like family
7	PF00069 Pkinase	1.2e-28	111.8	Protein kinase domain
8	PF17667 Pkinase_fungal	6.8e+02	10.4	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	3.1e-16	71.0	Protein tyrosine and serine/threonine kinase
10	PF03286 Pox_Ag35	1.5e+02	13.6	Pox virus Ag35 surface protein
11	PF17875 RPA43_OB	26	16.7	RPA43 OB domain in RNA Pol I
12	PF06459 RR_TM4-6	28	16.0	Ryanodine Receptor TM 4-6
13	PF08595 RXT2_N	19	16.7	RXT2-like, N-terminal
14	PF04546 Sigma70_ner	4e+02	12.3	Sigma-70, non-essential region
15	PF04177 TAP42	2.3e+02	12.3	TAP42-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259750

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252032	0.748	Uncharacterized protein C20orf194
2	9606.ENSP00000310565	0.725	Dermatan-sulfate epimerase-like protein
3	9606.ENSP00000340820	0.723	Microtubule-associated protein tau
4	9606.ENSP00000482657	0.708	Mitogen-activated protein kinase kinase kinase 14
5	9606.ENSP00000370719	0.683	Intersectin-1
6	9606.ENSP00000373647	0.638	Protein FAM83G
7	9606.ENSP00000304078	0.634	Protein FAM83B
8	9606.ENSP00000362480	0.592	Vacuolar protein sorting-associated protein 26A
9	9606.ENSP00000361650	0.571	Cysteine rich protein 3
10	9606.ENSP00000283109	0.563	Serine/threonine-protein kinase RIO2
11	9606.ENSP00000359353	0.553	Gamma-aminobutyric acid receptor subunit epsilon
12	9606.ENSP00000426119	0.553	Cysteine rich protein 2
13	9606.ENSP00000356548	0.547	Protein LTV1 homolog
14	9606.ENSP00000373565	0.511	Protein FAM83H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0050321	0.990	tau-protein kinase activity
GO:0004713	0.985	protein tyrosine kinase activity
GO:0048156	0.982	tau protein binding
GO:0106310	0.795	protein serine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.986	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0006793	0.981	phosphorus metabolic process
GO:0044238	0.980	primary metabolic process
GO:1901564	0.980	organonitrogen compound metabolic process
GO:0043170	0.926	macromolecule metabolic process
GO:0043412	0.901	macromolecule modification
GO:0032502	0.896	developmental process
GO:0019538	0.859	protein metabolic process
GO:0036211	0.854	protein modification process
GO:0006468	0.843	protein phosphorylation
GO:0019222	0.788	regulation of metabolic process
GO:0032501	0.695	multicellular organismal process
GO:0048518	0.640	positive regulation of biological process
GO:0051171	0.609	regulation of nitrogen compound metabolic process
GO:0048522	0.606	positive regulation of cellular process
GO:0080090	0.603	regulation of primary metabolic process
GO:0031323	0.600	regulation of cellular metabolic process
GO:0060255	0.597	regulation of macromolecule metabolic process
GO:0048519	0.557	negative regulation of biological process
GO:0048856	0.479	anatomical structure development
GO:0007275	0.444	multicellular organism development
GO:0018209	0.393	peptidyl-serine modification
GO:0051128	0.369	regulation of cellular component organization
GO:0048731	0.344	system development
GO:0050896	0.316	response to stimulus
GO:0048583	0.313	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005654	0.996	nucleoplasm
GO:0005829	0.993	cytosol
GO:0005856	0.990	cytoskeleton
GO:0036477	0.985	somatodendritic compartment
GO:0015630	0.982	microtubule cytoskeleton
GO:0043025	0.979	neuronal cell body
GO:0005875	0.963	microtubule associated complex
GO:0016020	0.668	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.26	0.990	[tau protein] kinase.
RHEA:10596	0.985	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
RHEA:17989	0.795	ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]

[back to server]