StarFunc result for job id Q5TCZ1

User Input

>input (1133 residues)
MLAYCVQDATVVDVEKRRNPSKHYVYIINVTWSDSTSQTIYRRYSKFFDLQMQLLDKFPI
EGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLKPIDEYCRALVRLPPHISQCDEVFRF
FEARPEDVNPPKEDYGSSKRKSVWLSSWAESPKKDVTGADATAEPMILEQYVVVSNYKKQ
ENSELSLQAGEVVDVIEKNESGWWFVSTSEEQGWVPATYLEAQNGTRDDSDINTSKTGEV
SKRRKAHLRRLDRRWTLGGMVNRQHSREEKYVTVQPYTSQSKDEIGFEKGVTVEVIRKNL
EGWWYIRYLGKEGWAPASYLKKAKDDLPTRKKNLAGPVEIIGNIMEISNLLNKKASGDKE
TPPAEGEGHEAPIAKKEISLPILCNASNGSAVGVPDRTVSRLAQGSPAVARIAPQRAQIS
SPNLRTRPPPRRESSLGFQLPKPPEPPSVEVEYYTIAEFQSCISDGISFRGGQKAEVIDK
NSGGWWYVQIGEKEGWAPASYIDKRKKPNLSRRTSTLTRPKVPPPAPPSKPKEAEEGPTG
ASESQDSPRKLKYEEPEYDIPAFGFDSEPELSEEPVEDRASGERRPAQPHRPSPASSLQR
ARFKVGESSEDVALEEETIYENEGFRPYAEDTLSARGSSGDSDSPGSSSLSLTRKNSPKS
GSPKSSSLLKLKAEKNAQAEMGKNHSSASFSSSITINTTCCSSSSSSSSSLSKTSGDLKP
RSASDAGIRGTPKVRAKKDADANAGLTSCPRAKPSVRPKPFLNRAESQSQEKMDISTLRR
QLRPTGQLRGGLKGSKSEDSELPPQTASEAPSEGSRRSSSDLITLPATTPPCPTKKEWEG
PATSYMTCSAYQKVQDSEISFPAGVEVQVLEKQESGWWYVRFGELEGWAPSHYLVLDENE
QPDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKT
SGTPAVKMRNGVRQVAVRPQSVFVSPPPKDNNLSCALRRNESLTATDGLRGVRRNSSFST
ARSAAAEAKGRLAERAASQGSDSPLLPAQRNSIPVSPVRPKPIEKSQFIHNNLKDVYVSI
ADYEGDEETAGFQEGVSMEVLERNPNGWWYCQILDGVKPFKGWVPSNYLEKKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TCZ1	1.000	1.000	0.000	1133	1.000	1.000	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
2	AFDB:Q1LYG0	0.288	0.291	1.110E-102	1119	0.594	0.601	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
3	AFDB:A2AAY5	0.220	0.263	1.047E-60	908	0.348	0.434	A2AAY5.pdb.gz	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
4	AFDB:A1X283	0.191	0.228	1.777E-59	911	0.341	0.424	A1X283.pdb.gz	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
5	AFDB:Q71F54	0.071	0.088	3.101E-18	894	0.121	0.153	Q71F54.pdb.gz	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
6	AFDB:A0A0B4KI34	0.080	0.092	3.006E-16	941	0.134	0.162	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
7	AFDB:Q9VA36	0.078	0.096	8.932E-16	882	0.137	0.176	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
8	PDB:2dybA	0.105	0.369	6.295E-12	298	0.041	0.158	2dybA.pdb.gz
9	AFDB:O13736	0.079	0.065	7.179E-9	1420	0.139	0.111	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
10	PDB:2eyzA	0.088	0.256	1.730E-6	304	0.029	0.109	2eyzA.pdb.gz
11	PDB:2lqnA	0.062	0.187	1.730E-6	303	0.033	0.122	2lqnA.pdb.gz
12	PDB:1griA	0.056	0.280	4.134E-6	211	0.026	0.137	1griA.pdb.gz
13	AFDB:Q9C0B9	0.083	0.080	2.234E-4	1178	0.130	0.125	Q9C0B9.pdb.gz	ZCHC2_HUMAN Zinc finger CCHC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZCCHC2 PE=1 SV=6
14	AFDB:Q10925	0.068	0.063	5.954E-4	1237	0.117	0.107	Q10925.pdb.gz	SID3_CAEEL Tyrosine-protein kinase sid-3 OS=Caenorhabditis elegans OX=6239 GN=sid-3 PE=1 SV=2
15	PDB:1ocuA	0.095	0.670	7.701E-4	134	0.023	0.194	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
16	PDB:3qwyA	0.048	0.311	8.587E-4	170	0.015	0.100	3qwyA.pdb.gz
17	PDB:6x5hA	0.050	0.119	1.743E-3	467	0.011	0.026	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
18	PDB:1k9aB	0.048	0.122	2.416E-3	441	0.010	0.025	1k9aB.pdb.gz
19	PDB:3ehqA	0.049	0.292	2.416E-3	182	0.009	0.055	3ehqA.pdb.gz
20	PDB:4mt6A	0.044	0.127	2.551E-3	389	0.013	0.039	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O89032	0.0	1963	1124	0.905	0.912	SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus OX=10090 GN=Sh3pxd2a PE=1 SV=2
2	Q1LYG0	0.0	1167	1119	0.598	0.606	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
3	Q5TCZ1	0.0	2310	1133	1.000	1.000	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
4	A2AAY5	1.05e-162	507	908	0.243	0.303	SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus OX=10090 GN=Sh3pxd2b PE=1 SV=1
5	A1X283	3.94e-162	506	911	0.238	0.296	SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3
6	P14598	2.97e-55	199	390	0.094	0.274	NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens OX=9606 GN=NCF1 PE=1 SV=4
7	B5X4S7	2.14e-53	194	413	0.093	0.254	B5X4S7_SALSA Neutrophil cytosol factor 1 OS=Salmo salar OX=8030 GN=SPD2A PE=2 SV=1
8	B8YQ98	7.00e-53	193	413	0.092	0.252	B8YQ98_SALSA NADPH oxidase cytosolic protein OS=Salmo salar OX=8030 GN=p47phox PE=2 SV=1
9	Q4Z8P3	1.39e-51	189	410	0.094	0.261	Q4Z8P3_DANRE Neutrophil cytosol factor 1 OS=Danio rerio OX=7955 GN=cb893 PE=2 SV=1
10	Q09014	2.03e-51	188	390	0.089	0.259	NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus OX=10090 GN=Ncf1 PE=1 SV=3
11	F1M707	3.20e-51	187	389	0.091	0.265	NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus OX=10116 GN=Ncf1 PE=1 SV=2
12	Q8VCM2	1.02e-21	100	349	0.069	0.223	NOXO1_MOUSE NADPH oxidase organizer 1 OS=Mus musculus OX=10090 GN=Noxo1 PE=2 SV=2
13	Q8NFA2	5.49e-17	86.7	376	0.065	0.197	NOXO1_HUMAN NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1 PE=1 SV=1
14	Q5AXF0	2.65e-13	76.6	616	0.037	0.068	Q5AXF0_EMENI Protein kinase activator Bem1, putative (AFU_orthologue AFUA_4G04120) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07030 PE=4 SV=1
15	F6NMW9	8.08e-13	75.9	1685	0.034	0.023	F6NMW9_DANRE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X2 OS=Danio rerio OX=7955 GN=pik3c2a PE=1 SV=1
16	D1MYR7	3.17e-11	69.7	573	0.030	0.059	D1MYR7_9HYPO Polarity protein BemA OS=Epichloe festucae OX=35717 GN=BemA PE=1 SV=1
17	A0A1D8PLB6	5.41e-11	69.3	632	0.031	0.055	A0A1D8PLB6_CANAL Phosphatidylinositol-3-phosphate-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM1 PE=4 SV=1
18	Q61194	1.92e-09	64.7	1686	0.028	0.019	P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus OX=10090 GN=Pik3c2a PE=1 SV=2
19	L7RRS0	1.93e-09	64.7	1686	0.028	0.019	L7RRS0_HUMAN Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=3 SV=1
20	O00443	1.93e-09	64.7	1686	0.028	0.019	P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens OX=9606 GN=PIK3C2A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14603 hSH3	13	17.7	Helically-extended SH3 domain
2	PF00787 PX	3.2e-11	55.1	PX domain
3	PF00018 SH3_1	4e-38	140.1	SH3 domain
4	PF07653 SH3_2	5.6e-32	120.7	Variant SH3 domain
5	PF08239 SH3_3	6.3e-10	50.6	Bacterial SH3 domain
6	PF14604 SH3_9	7.5e-28	107.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000011396

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000000739	0.847	ADAM metallopeptidase domain 12
2	9593.ENSGGOP00000005990	0.819	Growth factor receptor-bound protein 2
3	9593.ENSGGOP00000013558	0.783	ADAM metallopeptidase domain 15
4	9593.ENSGGOP00000007283	0.761	Tyrosine-protein kinase
5	9593.ENSGGOP00000017210	0.720	Wiskott-Aldrich syndrome-like
6	9593.ENSGGOP00000000730	0.717	Cyclin G associated kinase
7	9593.ENSGGOP00000021106	0.710	Phosphoinositide-3-kinase, regulatory subunit 4
8	9593.ENSGGOP00000002964	0.706	Cortactin
9	9593.ENSGGOP00000012229	0.689	Cytochrome b-245 light chain
10	9593.ENSGGOP00000008549	0.678	SET binding factor 2
11	9593.ENSGGOP00000017044	0.652	Cofilin 1 (non-muscle)
12	9593.ENSGGOP00000015095	0.651	Phosphatidylinositol 3-kinase, catalytic subunit type 3
13	9593.ENSGGOP00000024577	0.635	Werner syndrome, RecQ helicase-like
14	9593.ENSGGOP00000018193	0.625	Sorting nexin 4
15	9593.ENSGGOP00000024442	0.623	Tyrosine-protein kinase
16	9593.ENSGGOP00000001626	0.618	Matrix metallopeptidase 14 (membrane-inserted)
17	9593.ENSGGOP00000020436	0.615	Supervillin
18	9593.ENSGGOP00000010528	0.597	DnaJ (Hsp40) homolog, subfamily C, member 6
19	9593.ENSGGOP00000013845	0.592	SMC5-SMC6 complex localization factor 1
20	9593.ENSGGOP00000000489	0.585	SR-related CTD-associated factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.685	ion binding
GO:0043168	0.660	anion binding
GO:0035091	0.621	phosphatidylinositol binding
GO:1901981	0.367	phosphatidylinositol phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0032502	0.991	developmental process
GO:0008152	0.984	metabolic process
GO:0048856	0.982	anatomical structure development
GO:0044237	0.963	cellular metabolic process
GO:0030154	0.925	cell differentiation
GO:0032501	0.789	multicellular organismal process
GO:0048468	0.651	cell development
GO:0007275	0.594	multicellular organism development
GO:0009653	0.590	anatomical structure morphogenesis
GO:0065007	0.525	biological regulation
GO:0050789	0.524	regulation of biological process
GO:0071704	0.502	organic substance metabolic process
GO:0050794	0.472	regulation of cellular process
GO:0050896	0.393	response to stimulus
GO:0071840	0.377	cellular component organization or biogenesis
GO:0048646	0.376	anatomical structure formation involved in morphogenesis
GO:0016043	0.353	cellular component organization
GO:0044238	0.343	primary metabolic process
GO:0048731	0.306	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0002102	0.999	podosome
GO:0005829	0.985	cytosol
GO:0043231	0.825	intracellular membrane-bounded organelle
GO:0016020	0.567	membrane
GO:0012505	0.455	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]