StarFunc result for job id Q5TD97

User Input

>input (284 residues)
MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDR
HWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKG
NYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQ
LWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICF
QDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TD97	1.000	1.000	5.239E-63	284	1.000	1.000	Q5TD97.pdb.gz	FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens OX=9606 GN=FHL5 PE=1 SV=1
2	AFDB:Q9WTX7	0.971	0.971	3.537E-57	284	0.852	0.852	Q9WTX7.pdb.gz	FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus OX=10090 GN=Fhl5 PE=1 SV=1
3	AFDB:O35115	0.580	0.589	3.164E-45	279	0.581	0.591	O35115.pdb.gz	FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1
4	AFDB:M9MRX0	0.577	0.210	8.295E-41	989	0.472	0.135	M9MRX0.pdb.gz	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
5	AFDB:Q9R059	0.546	0.538	7.087E-40	289	0.472	0.464	Q9R059.pdb.gz	FHL3_MOUSE Four and a half LIM domains protein 3 OS=Mus musculus OX=10090 GN=Fhl3 PE=1 SV=2
6	AFDB:G5EDJ5	0.549	0.289	1.479E-39	619	0.468	0.215	G5EDJ5.pdb.gz	G5EDJ5_CAEEL LIM domain protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
7	AFDB:M9PFX9	0.680	0.384	2.271E-39	559	0.472	0.240	M9PFX9.pdb.gz	M9PFX9_DROME Limpet, isoform P OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
8	AFDB:Q8MYZ5	0.681	0.590	2.271E-39	339	0.472	0.395	Q8MYZ5.pdb.gz	Q8MYZ5_DROME RE37250p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=2 SV=1
9	AFDB:B0JZK9	0.541	0.548	1.428E-38	280	0.419	0.425	B0JZK9.pdb.gz
10	AFDB:A0A0K3AQM0	0.627	0.270	2.193E-38	793	0.468	0.168	A0A0K3AQM0.pdb.gz	A0A0K3AQM0_CAEEL Protein espinas OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=1
11	PDB:4kfzB	0.215	0.387	8.307E-9	148	0.109	0.209	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.214	0.309	1.533E-8	192	0.144	0.214	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.198	0.615	5.608E-3	76	0.074	0.276	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:5dkaA	0.108	0.296	6.921E-2	96	0.053	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:4kblA	0.136	0.109	8.844E-2	395	0.116	0.084	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
16	PDB:6slmA	0.101	0.061	1.535E-1	539	0.074	0.039	6slmA.pdb.gz	Structure of High-Risk Papillomavirus 31 E6 Oncogenic Protein and Characterization of E6/E6AP/p53 Complex Formation.
17	PDB:7q3nU	0.089	0.089	2.666E-1	292	0.077	0.075	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:7n9sA	0.138	0.034	3.850E-1	2365	0.109	0.013	7n9sA.pdb.gz
19	PDB:5gm6a	0.108	0.220	4.627E-1	123	0.074	0.171	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:4r8pL	0.079	0.085	5.562E-1	254	0.056	0.063	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TD97	0.0	580	284	1.000	1.000	FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens OX=9606 GN=FHL5 PE=1 SV=1
2	Q9WTX7	0.0	511	284	0.852	0.852	FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus OX=10090 GN=Fhl5 PE=1 SV=1
3	Q14192	1.47e-125	360	279	0.581	0.591	FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3
4	O35115	2.10e-125	360	279	0.577	0.588	FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1
5	O70433	4.83e-125	359	279	0.577	0.588	FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus OX=10090 GN=Fhl2 PE=1 SV=1
6	Q13643	3.97e-103	303	280	0.465	0.471	FHL3_HUMAN Four and a half LIM domains protein 3 OS=Homo sapiens OX=9606 GN=FHL3 PE=1 SV=4
7	Q3S1I9	1.65e-101	300	290	0.468	0.459	Q3S1I9_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
8	O17833	5.42e-100	303	486	0.468	0.274	O17833_CAEEL LIM domain family OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
9	G5EEA4	6.63e-99	302	564	0.468	0.236	G5EEA4_CAEEL LIM domain family OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
10	G5EDJ5	8.41e-99	304	619	0.468	0.215	G5EDJ5_CAEEL LIM domain protein OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=2
11	M9MRX0	1.98e-98	311	989	0.472	0.135	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
12	G5EF39	2.40e-98	303	656	0.468	0.203	G5EF39_CAEEL LIM domain family OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=1
13	Q9R059	2.81e-98	291	289	0.472	0.464	FHL3_MOUSE Four and a half LIM domains protein 3 OS=Mus musculus OX=10090 GN=Fhl3 PE=1 SV=2
14	A0A0K3AQM0	3.15e-97	304	793	0.468	0.168	A0A0K3AQM0_CAEEL Protein espinas OS=Caenorhabditis elegans OX=6239 GN=lim-9 PE=1 SV=1
15	Q9VVB7	3.36e-97	291	339	0.472	0.395	Q9VVB7_DROME FI02842p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
16	Q8MYZ5	3.54e-97	291	339	0.472	0.395	Q8MYZ5_DROME RE37250p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=2 SV=1
17	Q7KUQ5	4.07e-97	288	286	0.472	0.469	Q7KUQ5_DROME Limpet, isoform F OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
18	Q8IQQ3	1.63e-94	291	558	0.472	0.240	Q8IQQ3_DROME Limpet, isoform D OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
19	M9PFX9	2.10e-94	291	559	0.472	0.240	M9PFX9_DROME Limpet, isoform P OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
20	Q9VVB5	2.39e-94	290	559	0.472	0.240	Q9VVB5_DROME LD46723p OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	2.4e-42	154.3	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326022

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265372	0.973	cAMP responsive element modulator
2	9606.ENSP00000247986	0.960	Kinesin-like protein KIF17
3	9606.ENSP00000384863	0.929	Exportin-1
4	9606.ENSP00000216068	0.678	Dynein light chain 4, axonemal
5	9606.ENSP00000421246	0.613	Zinc finger protein 131
6	9606.ENSP00000306335	0.609	DNA-binding protein RFX2
7	9606.ENSP00000387699	0.592	Cyclic AMP-responsive element-binding protein 1
8	9606.ENSP00000358283	0.574	E3 UFM1-protein ligase 1
9	9606.ENSP00000356518	0.564	Testicular spindle-associated protein SHCBP1L
10	9606.ENSP00000265007	0.558	Transcription factor SOX-30
11	9606.ENSP00000275053	0.557	Protein MMS22-like
12	9606.ENSP00000358265	0.545	Kelch-like protein 32
13	9606.ENSP00000380155	0.528	Olfactory receptor 51E1
14	9606.ENSP00000282570	0.513	Germ cell-less protein-like 1
15	9606.ENSP00000320893	0.508	Ankyrin repeat and SOCS box protein 8
16	9606.ENSP00000338475	0.505	Succinate--hydroxymethylglutarate CoA-transferase
17	9606.ENSP00000358529	0.503	Tetraspanin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0050789	0.970	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0071704	0.883	organic substance metabolic process
GO:0044237	0.848	cellular metabolic process
GO:0048518	0.836	positive regulation of biological process
GO:0044238	0.795	primary metabolic process
GO:0048522	0.789	positive regulation of cellular process
GO:0006807	0.782	nitrogen compound metabolic process
GO:0019222	0.777	regulation of metabolic process
GO:0060255	0.773	regulation of macromolecule metabolic process
GO:0051171	0.760	regulation of nitrogen compound metabolic process
GO:0080090	0.759	regulation of primary metabolic process
GO:0031323	0.750	regulation of cellular metabolic process
GO:0010468	0.621	regulation of gene expression
GO:0006355	0.607	regulation of DNA-templated transcription
GO:0010604	0.588	positive regulation of macromolecule metabolic process
GO:0043170	0.577	macromolecule metabolic process
GO:0051173	0.576	positive regulation of nitrogen compound metabolic process
GO:0031325	0.561	positive regulation of cellular metabolic process
GO:0006357	0.494	regulation of transcription by RNA polymerase II
GO:1901360	0.476	organic cyclic compound metabolic process
GO:0046483	0.390	heterocycle metabolic process
GO:0045935	0.390	positive regulation of nucleobase-containing compound metabolic process
GO:0006725	0.389	cellular aromatic compound metabolic process
GO:0031328	0.382	positive regulation of cellular biosynthetic process
GO:0010557	0.381	positive regulation of macromolecule biosynthetic process
GO:0051254	0.381	positive regulation of RNA metabolic process
GO:0034641	0.380	cellular nitrogen compound metabolic process
GO:0045893	0.354	positive regulation of DNA-templated transcription
GO:1901576	0.352	organic substance biosynthetic process
GO:0044249	0.352	cellular biosynthetic process
GO:0019438	0.341	aromatic compound biosynthetic process
GO:0018130	0.341	heterocycle biosynthetic process
GO:1901362	0.340	organic cyclic compound biosynthetic process
GO:0006139	0.308	nucleobase-containing compound metabolic process
GO:0044271	0.305	cellular nitrogen compound biosynthetic process
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005634	0.961	nucleus
GO:0099080	0.700	supramolecular complex
GO:0030016	0.685	myofibril
GO:0030017	0.668	sarcomere
GO:0070013	0.517	intracellular organelle lumen
GO:0031981	0.473	nuclear lumen
GO:0005829	0.409	cytosol
GO:0005654	0.374	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]