StarFunc result for job id Q5TEA3

User Input

>input (1177 residues)
MDVYPPRRQGLPRARSPGGSSRGSPSVSCSRLRQVQSILTQSSKSRPDGILCILGIDSRY
NEGCRELANYLLFGLYNQNTSDFEKTGFSEEVLDDVIILIKSDSVHLYCNPVNFRYLLPY
VAHWRNLHFHCMTENEYEDEEAAEEFKITSFVDMVRDCSRIGIPYSSQGHLQIFDMFVVE
KWPIVQAFALEGIGGDGFFTMKYELQDVSLNLWNVYSKMDPMSLESLLSDDLVAFEHQWT
SFFANFDTEIPFLLELSESQAGEPFRSYFSHGMISSHITENSPNRQPFVLFGNHSTRENL
NAGNFNFPSEGHLVRSTGPGGSFAKHMVAQCVSPKGPLACSRTYFFGATHVPYLGGDSKL
PKKTEQIRLLSQIYAAVIEAVLAGIACYAKTSSLTKAKEVAEQTLGSGLDSFELIPFKAA
LRSKMTFHIHAVNNQGRIVPLDSEDSLSFVKTACMAVYDIPDLLGGNGCLGSVVFSESFL
TSQILVKEKDGTVTTETSSVVLTAAVPRFCSWLVEDNEVKLSEKTQQAVRGDESFLGTYL
TGGEGAYLYSSNLQSWPEEGNVHFFSSGLLFSHCRHRSIIISKDHMNSISFYDGDSTSTV
AALLIDFKSSLLPHLPVHFHGSSNFLMIALFPKSKIYQAFYSEVFSLWKQQDNSGISLKV
IQEDGLSVEQKRLHSSAQKLFSALSQPAGEKRSSLKLLSAKLPELDWFLQHFAISSISQE
PVMRTHLPVLLQQAEINTTHRIESDKVIISIVTGLPGCHASELCAFLVTLHKECGRWMVY
RQIMDSSECFHAAHFQRYLSSALEAQQNRSARQSAYIRKKTRLLVVLQGYTDVIDVVQAL
QTHPDSNVKASFTIGAITACVEPMSCYMEHRFLFPKCLDQCSQGLVSNVVFTSHTTEQRH
PLLVQLQSLIRAANPAAAFILAENGIVTRNEDIELILSENSFSSPEMLRSRYLMYPGWYE
GKLNAGSVYPLMVQICVWFGRPLEKTRFVAKCKAIQSSIKPSPFSGNIYHILGKVKFSDS
ERTMEVCYNTLANSLSIMPVLEGPTPPPDSKSVSQDSSGQQECYLVFIGCSLKEDSIKDW
LRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHP
LMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TEA3	1.000	1.000	0.000	1177	1.000	1.000	Q5TEA3.pdb.gz	DAAF9_HUMAN Dynein axonemal assembly factor 9 OS=Homo sapiens OX=9606 GN=DNAAF9 PE=1 SV=1
2	AFDB:Q9N5R9	0.225	0.251	4.741E-15	1030	0.074	0.084	Q9N5R9.pdb.gz	SPT16_CAEEL FACT complex subunit spt-16 OS=Caenorhabditis elegans OX=6239 GN=spt-16 PE=1 SV=1
3	AFDB:O82491	0.193	0.207	3.610E-14	1074	0.076	0.083	O82491.pdb.gz	SPT16_ARATH FACT complex subunit SPT16 OS=Arabidopsis thaliana OX=3702 GN=SPT16 PE=1 SV=1
4	AFDB:Q9W603	0.203	0.223	6.743E-14	1035	0.075	0.085	Q9W603.pdb.gz	SP16H_XENLA FACT complex subunit SPT16 OS=Xenopus laevis OX=8355 GN=supt16h PE=1 SV=2
5	AFDB:Q8IRG6	0.199	0.211	9.708E-14	1083	0.065	0.070	Q8IRG6.pdb.gz	SPT16_DROME FACT complex subunit spt16 OS=Drosophila melanogaster OX=7227 GN=dre4 PE=1 SV=2
6	AFDB:Q9Y5B9	0.205	0.225	2.352E-13	1047	0.065	0.074	Q9Y5B9.pdb.gz	SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1
7	AFDB:P32558	0.201	0.223	9.591E-13	1035	0.071	0.080	P32558.pdb.gz	SPT16_YEAST FACT complex subunit SPT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT16 PE=1 SV=1
8	AFDB:O94267	0.218	0.244	1.244E-12	1019	0.062	0.072	O94267.pdb.gz	SPT16_SCHPO FACT complex subunit spt16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt16 PE=1 SV=1
9	AFDB:Q5JTY5	0.139	0.380	2.862E-12	395	0.045	0.134	Q5JTY5.pdb.gz	ZNG1C_HUMAN Zinc-regulated GTPase metalloprotein activator 1C OS=Homo sapiens OX=9606 GN=ZNG1C PE=1 SV=1
10	AFDB:P53729	0.136	0.340	4.572E-12	429	0.058	0.159	P53729.pdb.gz	ZNG1_YEAST Zinc-regulated GTPase metalloprotein activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZNG1 PE=1 SV=1
11	PDB:4ixmA	0.121	0.394	4.045E-10	318	0.042	0.154	4ixmA.pdb.gz	Metal binding properties of Escherichia coli YjiA, a member of the metal homeostasis-associated COG0523 family of GTPases.
12	PDB:5cnxA	0.195	0.507	5.684E-8	360	0.049	0.161	5cnxA.pdb.gz	Structures and activities of widely conserved small prokaryotic aminopeptidases-P clarify classification of M24B peptidases
13	PDB:6yo9A	0.167	0.396	3.007E-7	398	0.048	0.141	6yo9A.pdb.gz	Degradation of the microbial stress protectants and chemical chaperones ectoine and hydroxyectoine by a bacterial hydrolase-deacetylase complex.
14	PDB:5x49A	0.194	0.438	6.232E-7	441	0.065	0.172	5x49A.pdb.gz	Structure of the human aminopeptidase XPNPEP3 and comparison of its in vitro activity with Icp55 orthologs: Insights into diverse cellular processes.
15	PDB:3ctzA	0.167	0.280	2.412E-6	617	0.047	0.089	3ctzA.pdb.gz	Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
16	PDB:4s2rP	0.156	0.265	5.549E-6	615	0.044	0.085	4s2rP.pdb.gz	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
17	PDB:5mc1B	0.190	0.401	6.751E-5	485	0.046	0.111	5mc1B.pdb.gz	Structural basis for prolidase deficiency disease mechanisms.
18	PDB:6srgA	0.197	0.431	1.024E-4	455	0.048	0.125	6srgA.pdb.gz	Co-expression with chaperones can affect protein 3D structure as exemplified by loss-of-function variants of human prolidase.
19	PDB:6upkH	0.078	0.193	8.214E-4	411	0.023	0.066	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
20	PDB:7nkyQ	0.071	0.189	4.822E-3	404	0.022	0.064	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TEA3	0.0	2451	1177	1.000	1.000	DAAF9_HUMAN Dynein axonemal assembly factor 9 OS=Homo sapiens OX=9606 GN=DNAAF9 PE=1 SV=1
2	O01635	0.58	37.0	823	0.033	0.047	ASIC1_CAEEL Degenerin-like protein asic-1 OS=Caenorhabditis elegans OX=6239 GN=asic-1 PE=3 SV=2
3	Q7JUY7	1.8	35.0	517	0.024	0.054	CED6_DROME PTB domain-containing adapter protein ced-6 OS=Drosophila melanogaster OX=7227 GN=ced-6 PE=1 SV=1
4	Q5Q0H6	2.3	33.9	193	0.020	0.124	Q5Q0H6_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=MOS9 PE=1 SV=1
5	Q382A5	3.3	33.1	187	0.019	0.118	Q382A5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5920 PE=4 SV=1
6	Q9BW91	3.3	33.9	350	0.021	0.071	NUDT9_HUMAN ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 PE=1 SV=1
7	P32383	4.4	33.9	869	0.035	0.047	PLC1_YEAST 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PLC1 PE=1 SV=1
8	Q8BVU5	5.7	33.1	350	0.024	0.080	NUDT9_MOUSE ADP-ribose pyrophosphatase, mitochondrial OS=Mus musculus OX=10090 GN=Nudt9 PE=1 SV=1
9	Q9JI58	7.4	32.7	249	0.015	0.072	RAE1D_MOUSE Retinoic acid early-inducible protein 1-delta OS=Mus musculus OX=10090 GN=Raet1d PE=1 SV=1
10	P04819	7.7	33.1	755	0.019	0.029	DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC9 PE=1 SV=2
11	Q98SI3	9.7	31.6	174	0.021	0.144	Q98SI3_CYPCA Apolipoprotein A-I (Fragment) OS=Cyprinus carpio OX=7962 GN=apoA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13289 SIR2_2	39	15.8	SIR2-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259750	0.748	Tau-tubulin kinase 1
2	9606.ENSP00000482657	0.727	Mitogen-activated protein kinase kinase kinase 14
3	9606.ENSP00000064778	0.640	Protein FAM168A
4	9606.ENSP00000346127	0.632	Pleckstrin homology domain-containing family B member 1
5	9606.ENSP00000370719	0.611	Intersectin-1
6	9606.ENSP00000310565	0.610	Dermatan-sulfate epimerase-like protein
7	9606.ENSP00000342699	0.602	Cilia- and flagella-associated protein 36
8	9606.ENSP00000369456	0.601	Inosine triphosphate pyrophosphatase
9	9606.ENSP00000362480	0.580	Vacuolar protein sorting-associated protein 26A
10	9606.ENSP00000379256	0.551	Neurocalcin-delta
11	9606.ENSP00000359353	0.544	Gamma-aminobutyric acid receptor subunit epsilon
12	9606.ENSP00000308219	0.535	RGM domain family member B
13	9606.ENSP00000260746	0.530	ADP-ribosylation factor-like protein 3
14	9606.ENSP00000409000	0.503	Interferon lambda-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.878	regulation of biological process
GO:0050794	0.820	regulation of cellular process
GO:0008152	0.426	metabolic process
GO:0048522	0.339	positive regulation of cellular process
GO:0071704	0.333	organic substance metabolic process
GO:0044238	0.306	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.998	membrane-bounded organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005829	0.939	cytosol
GO:0005634	0.706	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]