StarFunc result for job id Q5TEU4

User Input

>input (345 residues)
MLRPAGLWRLCRRPWAARVPAENLGRREVTSGVSPRGSTSPRTLNIFDRDLKRKQKNWAA
RQPEPTKFDYLKEEVGSRIADRVYDIPRNFPLALDLGCGRGYIAQYLNKETIGKFFQADI
AENALKNSSETEIPTVSVLADEEFLPFKENTFDLVVSSLSLHWVNDLPRALEQIHYILKP
DGVFIGAMFGGDTLYELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTLTVD
TDEIQVNYPGMFELMEDLQGMGESNCAWNRKALLHRDTMLAAAAVYREMYRNEDGSVPAT
YQIYYMIGWKYHESQARPAERGSATVSFGELGKINNLMPPGKKSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TEU4	1.000	1.000	9.313E-75	345	1.000	1.000	Q5TEU4.pdb.gz	NDUF5_HUMAN Arginine-hydroxylase NDUFAF5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF5 PE=1 SV=1
2	AFDB:A2APY7	0.880	0.885	1.143E-66	343	0.843	0.848	A2APY7.pdb.gz	NDUF5_MOUSE Arginine-hydroxylase NDUFAF5, mitochondrial OS=Mus musculus OX=10090 GN=Ndufaf5 PE=1 SV=1
3	AFDB:Q54JW0	0.787	0.627	6.980E-40	436	0.374	0.296	Q54JW0.pdb.gz	NDUF5_DICDI Arginine-hydroxylase NDUFAF5, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=ndufaf5 PE=1 SV=1
4	AFDB:P12999	0.643	0.865	5.767E-20	251	0.148	0.203	P12999.pdb.gz	BIOC_ECOLI Malonyl-[acyl-carrier protein] O-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=bioC PE=1 SV=2
5	AFDB:Q54818	0.541	0.639	5.483E-16	286	0.145	0.175	Q54818.pdb.gz	DNRC_STRPE Aklanonic acid methyltransferase DnrC OS=Streptomyces peucetius OX=1950 GN=dnrC PE=1 SV=1
6	AFDB:Q767F1	0.521	0.631	1.010E-15	278	0.177	0.219	Q767F1.pdb.gz	JHAMT_BOMMO Juvenile hormone acid O-methyltransferase OS=Bombyx mori OX=7091 GN=JHAMT PE=1 SV=1
7	AFDB:P76145	0.562	0.744	5.934E-15	252	0.128	0.175	P76145.pdb.gz	TAM_ECOLI Trans-aconitate 2-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=tam PE=1 SV=3
8	AFDB:O74529	0.521	0.676	7.127E-15	260	0.125	0.165	O74529.pdb.gz	YJ48_SCHPO Uncharacterized methyltransferase C70.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.08c PE=3 SV=1
9	AFDB:Q55EX9	0.475	0.592	1.483E-14	263	0.145	0.190	Q55EX9.pdb.gz	Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268948 PE=1 SV=2
10	AFDB:O53285	0.446	0.468	2.013E-14	327	0.171	0.180	O53285.pdb.gz	O53285_MYCTO Methyltransferase type 11 domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3123 PE=4 SV=1
11	PDB:5wp4A	0.472	0.346	4.384E-12	485	0.116	0.082	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
12	PDB:4ineA	0.466	0.381	5.266E-12	431	0.136	0.109	4ineA.pdb.gz	Crystal structure of N-methyl transferase (PMT-2) from Caenorhabditis elegant complexed with S-adenosyl homocysteine and phosphoethanolamine
13	PDB:5wp5A	0.451	0.344	5.266E-12	463	0.128	0.095	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
14	PDB:1p91A	0.427	0.532	7.146E-12	268	0.125	0.160	1p91A.pdb.gz	Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.
15	PDB:6bqcA	0.391	0.388	1.340E-10	348	0.113	0.112	6bqcA.pdb.gz	Structural and Functional Analysis of E. coli Cyclopropane Fatty Acid Synthase.
16	PDB:7wttq	0.364	0.514	4.275E-10	235	0.139	0.204	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:4f86A	0.375	0.459	4.830E-10	275	0.104	0.131	4f86A.pdb.gz	Structure analysis of geranyl pyrophosphate methyltransferase and the proposed reaction mechanism of SAM-dependent C-methylation
18	PDB:5mgzA	0.395	0.563	6.555E-10	230	0.107	0.161	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
19	PDB:2aouB	0.436	0.504	8.896E-10	289	0.113	0.135	2aouB.pdb.gz	Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
20	PDB:4iwnA	0.385	0.556	1.005E-9	229	0.084	0.127	4iwnA.pdb.gz	S-Adenosyl-S-carboxymethyl-L-homocysteine: a novel cofactor found in the putative tRNA-modifying enzyme CmoA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2APY7	0.0	613	343	0.843	0.848	NDUF5_MOUSE Arginine-hydroxylase NDUFAF5, mitochondrial OS=Mus musculus OX=10090 GN=Ndufaf5 PE=1 SV=1
2	Q5TEU4	0.0	719	345	1.000	1.000	NDUF5_HUMAN Arginine-hydroxylase NDUFAF5, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAF5 PE=1 SV=1
3	Q54JW0	1.33e-76	243	436	0.371	0.294	NDUF5_DICDI Arginine-hydroxylase NDUFAF5, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=ndufaf5 PE=1 SV=1
4	P12999	2.23e-09	59.7	251	0.142	0.195	BIOC_ECOLI Malonyl-[acyl-carrier protein] O-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=bioC PE=1 SV=2
5	O53285	1.59e-06	51.6	327	0.099	0.104	O53285_MYCTO Methyltransferase type 11 domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3123 PE=4 SV=1
6	P0A887	6.97e-06	48.9	251	0.101	0.139	UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) OX=83333 GN=ubiE PE=1 SV=1
7	Q767F1	1.84e-05	48.1	278	0.159	0.198	JHAMT_BOMMO Juvenile hormone acid O-methyltransferase OS=Bombyx mori OX=7091 GN=JHAMT PE=1 SV=1
8	Q9SIZ3	8.71e-05	46.6	589	0.119	0.070	PMTN_ARATH Probable methyltransferase PMT23 OS=Arabidopsis thaliana OX=3702 GN=At2g40280 PE=2 SV=2
9	Q4WAZ0	1.46e-04	46.2	905	0.078	0.030	PSOF_ASPFU Dual-functional monooxygenase/methyltransferase psoF OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=psoF PE=1 SV=1
10	Q9TYP1	1.63e-04	45.4	334	0.093	0.096	STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans OX=6239 GN=strm-1 PE=1 SV=2
11	Q9CXI0	3.65e-04	44.3	327	0.058	0.061	COQ5_MOUSE 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq5 PE=1 SV=2
12	O43709	4.21e-04	43.9	281	0.090	0.110	BUD23_HUMAN Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23 PE=1 SV=2
13	Q9XBC9	6.84e-04	43.1	259	0.084	0.112	Q9XBC9_AMYOR Putative rRNA methylase OS=Amycolatopsis orientalis OX=31958 GN=CZA382.22c PE=4 SV=1
14	Q55214	0.001	42.0	220	0.128	0.200	DNRC_STRS5 Aklanonic acid methyltransferase DauC OS=Streptomyces sp. (strain C5) OX=45212 GN=dauC PE=1 SV=1
15	Q9LN50	0.001	43.5	724	0.110	0.052	PMTS_ARATH Probable methyltransferase PMT28 OS=Arabidopsis thaliana OX=3702 GN=At1g19430 PE=2 SV=1
16	P38892	0.002	41.6	291	0.078	0.093	CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRG1 PE=1 SV=1
17	Q54D70	0.002	41.6	347	0.070	0.069	Q54D70_DICDI Methyltransferase type 11 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292448 PE=4 SV=1
18	Q5HYK3	0.002	41.6	327	0.055	0.058	COQ5_HUMAN 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ5 PE=1 SV=2
19	O22285	0.003	41.6	694	0.099	0.049	PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana OX=3702 GN=At2g39750 PE=2 SV=1
20	Q8LBV4	0.003	41.6	355	0.090	0.087	Y1814_ARATH Uncharacterized methyltransferase At1g78140, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g78140 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	1.3e-15	69.1	Methyltransferase domain
2	PF08242 Methyltransf_12	1.4e-07	43.5	Methyltransferase domain
3	PF13489 Methyltransf_23	2e-11	55.5	Methyltransferase domain
4	PF13649 Methyltransf_25	4.6e-11	54.6	Methyltransferase domain
5	PF03141 Methyltransf_29	0.096	22.9	Putative S-adenosyl-L-methionine-dependent methyltransferase
6	PF13847 Methyltransf_31	2.3e-06	38.9	Methyltransferase domain
7	PF13679 Methyltransf_32	7.8e+02	11.5	Methyltransferase domain
8	PF03492 Methyltransf_7	94	13.6	SAM dependent carboxyl methyltransferase
9	PF07021 MetW	6	18.0	Methionine biosynthesis protein MetW
10	PF05175 MTS	16	16.6	Methyltransferase small domain
11	PF01209 Ubie_methyltran	0.00052	31.0	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
2	9606.ENSP00000323076	0.989	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3
3	9606.ENSP00000379430	0.972	NADH dehydrogenase (ubiquinone) complex I, assembly factor 6
4	9606.ENSP00000002125	0.966	Protein arginine methyltransferase NDUFAF7, mitochondrial
5	9606.ENSP00000312618	0.942	Acyl-CoA dehydrogenase family member 9, mitochondrial
6	9606.ENSP00000358272	0.918	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4
7	9606.ENSP00000315774	0.910	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
8	9606.ENSP00000260361	0.908	Complex I intermediate-associated protein 30, mitochondrial
9	9606.ENSP00000354687	0.902	NADH-ubiquinone oxidoreductase chain 1
10	9606.ENSP00000356972	0.900	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
11	9606.ENSP00000400184	0.888	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8
12	9606.ENSP00000263774	0.886	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
13	9606.ENSP00000237889	0.871	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
14	9606.ENSP00000351737	0.864	Complex I assembly factor TMEM126B, mitochondrial
15	9606.ENSP00000458770	0.863	Acyl carrier protein, mitochondrial
16	9606.ENSP00000417142	0.859	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
17	9606.ENSP00000252102	0.843	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
18	9606.ENSP00000270517	0.833	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
19	9606.ENSP00000330737	0.823	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
20	9606.ENSP00000354813	0.822	NADH-ubiquinone oxidoreductase chain 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008168	0.988	methyltransferase activity
GO:0008757	0.822	S-adenosylmethionine-dependent methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032981	0.995	mitochondrial respiratory chain complex I assembly
GO:0008152	0.994	metabolic process
GO:0044238	0.981	primary metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0071704	0.957	organic substance metabolic process
GO:0018193	0.933	peptidyl-amino acid modification
GO:0018195	0.844	peptidyl-arginine modification
GO:0044237	0.591	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.992	membrane
GO:0031090	0.973	organelle membrane
GO:0031966	0.958	mitochondrial membrane
GO:0005743	0.942	mitochondrial inner membrane
GO:0032991	0.922	protein-containing complex
GO:0070013	0.319	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.988	Methyltransferases.

[back to server]