StarFunc result for job id Q5TFE4

User Input

>input (455 residues)
MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKELLNVTPEDWD
FCCKGLALDLEDGNFLKLANNGTVLRASHGTKMMTPEVLAEAYGKKEWKHFLSDTGMACR
SGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTFDFWKDIVAAIQHNYKMSAFKENCG
IYFPEIKRDPGRYLHSCPESVKKWLRQLKNAGKILLLITSSHSDYCRLLCEYILGNDFTD
LFDIVITNALKPGFFSHLPSQRPFRTLENDEEQEALPSLDKPGWYSQGNAVHLYELLKKM
TGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEESEPLEKKGKY
EGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCKRISTYSTIAIPSIEAIAELP
LDYKFTRFSSSNSKTAGYYPNPPLVLSSDETLISK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5ZZB6	0.628	0.623	5.262E-26	459	0.193	0.192	Q5ZZB6.pdb.gz	Q5ZZB6_LEGPH Cytosolic IMP-GMP specific 5'-nucleotidase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpg0095 PE=1 SV=1
2	AFDB:Q66I11	0.694	0.613	1.002E-25	518	0.222	0.195	Q66I11.pdb.gz	Q66I11_DANRE 5'-nucleotidase, cytosolic II,-like 1 OS=Danio rerio OX=7955 GN=zgc:92102 PE=1 SV=1
3	AFDB:F4K3A9	0.695	0.504	8.758E-25	642	0.237	0.168	F4K3A9.pdb.gz	F4K3A9_ARATH HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase OS=Arabidopsis thaliana OX=3702 GN=At5g48960 PE=1 SV=1
4	AFDB:Q86UY8	0.712	0.598	1.769E-24	548	0.240	0.199	Q86UY8.pdb.gz	NT5D3_HUMAN 5'-nucleotidase domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NT5DC3 PE=1 SV=1
5	PDB:4ohfB	0.614	0.610	5.934E-24	458	0.193	0.192	4ohfB.pdb.gz	Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
6	AFDB:Q54XC1	0.698	0.545	2.158E-22	592	0.242	0.186	Q54XC1.pdb.gz	5NTC_DICDI Cytosolic purine 5'-nucleotidase OS=Dictyostelium discoideum OX=44689 GN=nt5c2 PE=3 SV=1
7	AFDB:Q5ZIZ4	0.681	0.550	1.885E-21	569	0.200	0.160	Q5ZIZ4.pdb.gz	5NTC_CHICK Cytosolic purine 5'-nucleotidase OS=Gallus gallus OX=9031 GN=NT5C2 PE=1 SV=1
8	PDB:2xjeA	0.698	0.684	2.785E-21	465	0.191	0.187	2xjeA.pdb.gz	Structural Basis for the Allosteric Regulation and Substrate Recognition of Human Cytosolic 5'-Nucleotidase II
9	PDB:6ddqA	0.676	0.612	5.305E-21	507	0.200	0.179	6ddqA.pdb.gz
10	AFDB:P32662	0.312	0.509	8.871E-6	252	0.101	0.183	P32662.pdb.gz	GPH_ECOLI Phosphoglycolate phosphatase OS=Escherichia coli (strain K12) OX=83333 GN=gph PE=1 SV=1
11	AFDB:Q72H00	0.241	0.403	2.136E-5	249	0.119	0.217	Q72H00.pdb.gz	PSP_THET2 Phosphoserine phosphatase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=TT_C1695 PE=1 SV=1
12	AFDB:Q5M969	0.262	0.442	2.265E-5	248	0.099	0.181	Q5M969.pdb.gz	NANP_RAT N-acylneuraminate-9-phosphatase OS=Rattus norvegicus OX=10116 GN=Nanp PE=1 SV=1
13	PDB:2w4mA	0.262	0.440	1.447E-4	250	0.101	0.184	2w4mA.pdb.gz
14	AFDB:O48587	0.273	0.442	1.565E-4	255	0.088	0.157	O48587.pdb.gz	O48587_ARATH At5g44730 OS=Arabidopsis thaliana OX=3702 GN=T19K24.16 PE=1 SV=1
15	PDB:7ef7A	0.284	0.494	5.568E-4	236	0.095	0.182	7ef7A.pdb.gz	Initiation of cytosolic plant purine nucleotide catabolism involves a monospecific xanthosine monophosphate phosphatase.
16	PDB:4uauA	0.239	0.443	1.265E-3	226	0.075	0.150	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
17	PDB:1ynsA	0.244	0.384	6.914E-3	254	0.084	0.150	1ynsA.pdb.gz	Crystal structure of human e1 enzyme and its complex with a substrate analog reveals the mechanism of its phosphatase/enolase
18	PDB:5olwA	0.263	0.475	1.765E-2	224	0.075	0.152	5olwA.pdb.gz	Observing enzyme ternary transition state analogue complexes by19F NMR spectroscopy.
19	PDB:3k1zA	0.215	0.366	2.232E-2	241	0.070	0.133	3k1zA.pdb.gz
20	PDB:4g9bA	0.224	0.405	2.366E-2	227	0.088	0.176	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86UY8	2.81e-27	116	548	0.231	0.192	NT5D3_HUMAN 5'-nucleotidase domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NT5DC3 PE=1 SV=1
2	Q3UHB1	2.05e-25	111	546	0.264	0.220	NT5D3_MOUSE 5'-nucleotidase domain-containing protein 3 OS=Mus musculus OX=10090 GN=Nt5dc3 PE=1 SV=1
3	F4K3A9	9.03e-25	109	642	0.222	0.157	F4K3A9_ARATH HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase OS=Arabidopsis thaliana OX=3702 GN=At5g48960 PE=1 SV=1
4	Q5ZZB6	8.91e-22	99.8	459	0.222	0.220	Q5ZZB6_LEGPH Cytosolic IMP-GMP specific 5'-nucleotidase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpg0095 PE=1 SV=1
5	Q54XC1	6.76e-21	97.8	592	0.213	0.164	5NTC_DICDI Cytosolic purine 5'-nucleotidase OS=Dictyostelium discoideum OX=44689 GN=nt5c2 PE=3 SV=1
6	Q66I11	4.78e-17	85.9	518	0.202	0.178	Q66I11_DANRE 5'-nucleotidase, cytosolic II,-like 1 OS=Danio rerio OX=7955 GN=zgc:92102 PE=1 SV=1
7	Q5ZIZ4	8.39e-14	75.9	569	0.204	0.163	5NTC_CHICK Cytosolic purine 5'-nucleotidase OS=Gallus gallus OX=9031 GN=NT5C2 PE=1 SV=1
8	D3ZMY7	1.50e-13	75.1	560	0.211	0.171	5NTC_RAT Cytosolic purine 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c2 PE=1 SV=4
9	Q3V1L4	7.86e-13	72.8	560	0.209	0.170	5NTC_MOUSE Cytosolic purine 5'-nucleotidase OS=Mus musculus OX=10090 GN=Nt5c2 PE=1 SV=2
10	P49902	1.06e-12	72.4	561	0.209	0.169	5NTC_HUMAN Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2 PE=1 SV=1
11	O46411	1.43e-12	72.0	560	0.209	0.170	5NTC_BOVIN Cytosolic purine 5'-nucleotidase OS=Bos taurus OX=9913 GN=NT5C2 PE=1 SV=1
12	P35614	0.24	36.2	435	0.088	0.092	ERF1Z_ARATH Eukaryotic peptide chain release factor subunit 1-3 OS=Arabidopsis thaliana OX=3702 GN=ERF1-3 PE=1 SV=1
13	Q39097	0.80	34.7	436	0.057	0.060	ERF1X_ARATH Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana OX=3702 GN=ERF1-1 PE=1 SV=2
14	Q9LPV8	0.90	34.3	434	0.040	0.041	ERF1Y_ARATH Eukaryotic peptide chain release factor subunit 1-2 OS=Arabidopsis thaliana OX=3702 GN=ERF1-2 PE=1 SV=1
15	D2K759	0.96	34.3	435	0.040	0.041	ERF1Y_BRAOB Eukaryotic peptide chain release factor subunit 1-2 OS=Brassica oleracea var. botrytis OX=3715 GN=ERF1-2 PE=1 SV=1
16	P0C2J7	1.1	34.3	1802	0.055	0.014	YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY4B-H PE=3 SV=1
17	Q803E5	2.8	32.7	442	0.051	0.052	Q803E5_DANRE Eukaryotic peptide chain release factor subunit 1 OS=Danio rerio OX=7955 GN=etf1 PE=1 SV=1
18	P47024	3.6	32.7	1803	0.059	0.015	YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY4B-J PE=3 SV=3
19	M9PGI7	3.7	32.7	911	0.051	0.025	M9PGI7_DROME Serine/threonine-protein kinase PRP4 homolog OS=Drosophila melanogaster OX=7227 GN=Prp4k PE=1 SV=1
20	X2JAG8	3.7	32.7	912	0.051	0.025	X2JAG8_DROME Serine/threonine-protein kinase PRP4 homolog OS=Drosophila melanogaster OX=7227 GN=Prp4k PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05761 5_nucleotid	2.3e-56	203.2	5' nucleotidase family
2	PF13242 Hydrolase_like	96	14.5	HAD-hyrolase-like
3	PF00886 Ribosomal_S16	3.8e+02	12.5	Ribosomal protein S16

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326858

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303468	0.730	Zinc finger CCHC domain-containing protein 4
2	9606.ENSP00000358071	0.677	SEC23-interacting protein
3	9606.ENSP00000410943	0.651	Testis-specific Y-encoded-like protein 4
4	9606.ENSP00000374399	0.603	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
5	9606.ENSP00000368986	0.560	Olfactory receptor 6C65
6	9606.ENSP00000406145	0.519	Cortexin-2
7	9606.ENSP00000357597	0.507	Testis-specific Y-encoded-like protein 1
8	9606.ENSP00000365883	0.504	Nucleoside diphosphate-linked moiety X motif 8
9	9606.ENSP00000307567	0.502	Glutamine--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	0.999	protein binding
GO:0016791	0.988	phosphatase activity
GO:0008252	0.948	nucleotidase activity
GO:0008253	0.940	5'-nucleotidase activity
GO:0042802	0.897	identical protein binding
GO:0050483	0.549	IMP 5'-nucleotidase activity
GO:0016740	0.370	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044237	0.986	cellular metabolic process
GO:0006793	0.979	phosphorus metabolic process
GO:0071704	0.957	organic substance metabolic process
GO:0044238	0.936	primary metabolic process
GO:0044281	0.926	small molecule metabolic process
GO:0006807	0.905	nitrogen compound metabolic process
GO:0034641	0.823	cellular nitrogen compound metabolic process
GO:0046483	0.780	heterocycle metabolic process
GO:0006725	0.779	cellular aromatic compound metabolic process
GO:0006139	0.757	nucleobase-containing compound metabolic process
GO:0006796	0.686	phosphate-containing compound metabolic process
GO:0055086	0.534	nucleobase-containing small molecule metabolic process
GO:1901564	0.481	organonitrogen compound metabolic process
GO:0019637	0.474	organophosphate metabolic process
GO:1901135	0.470	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.984	cytosol
GO:0043226	0.921	organelle
GO:0043231	0.849	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.988	Phosphoric monoester hydrolases.
RHEA:22140	0.948	a nucleoside 5'-phosphate + H2O = a nucleoside + phosphate
RHEA:12484	0.940	a ribonucleoside 5'-phosphate + H2O = a ribonucleoside + phosphate
EC:3.1.3.5	0.940	5'-nucleotidase.
RHEA:27718	0.549	H2O + IMP = inosine + phosphate
EC:2.-.-.-	0.370	Transferases.

[back to server]