StarFunc result for job id Q5TGI4

User Input

>input (173 residues)
MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVR
RLREQDANAAGLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSR
ELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TGI4	1.000	1.000	2.564E-26	173	1.000	1.000	Q5TGI4.pdb.gz	SAMD5_HUMAN Sterile alpha motif domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SAMD5 PE=1 SV=1
2	AFDB:Q3V1H9	0.583	0.583	5.049E-22	173	0.896	0.896	Q3V1H9.pdb.gz	SAMD5_MOUSE Sterile alpha motif domain-containing protein 5 OS=Mus musculus OX=10090 GN=Samd5 PE=1 SV=1
3	AFDB:A0A0B4K6C1	0.374	0.065	2.894E-5	1034	0.387	0.065	A0A0B4K6C1.pdb.gz	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
4	AFDB:Q0KI30	0.379	0.063	4.414E-5	1064	0.370	0.060	Q0KI30.pdb.gz	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2
5	AFDB:P57725	0.378	0.181	6.732E-5	372	0.133	0.062	P57725.pdb.gz	SAMN1_MOUSE SAM domain-containing protein SAMSN-1 OS=Mus musculus OX=10090 GN=Samsn1 PE=1 SV=2
6	AFDB:P29323	0.423	0.083	3.228E-4	1055	0.185	0.030	P29323.pdb.gz	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
7	AFDB:Q9NSI8	0.376	0.182	5.554E-4	373	0.156	0.072	Q9NSI8.pdb.gz	SAMN1_HUMAN SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1
8	AFDB:F1LM60	0.320	0.042	6.655E-4	1443	0.231	0.028	F1LM60.pdb.gz	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
9	AFDB:Q8K352	0.399	0.185	7.069E-4	380	0.139	0.063	Q8K352.pdb.gz	SASH3_MOUSE SAM and SH3 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Sash3 PE=1 SV=2
10	AFDB:Q5T7B8	0.381	0.053	1.548E-3	1368	0.127	0.016	Q5T7B8.pdb.gz	KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2
11	PDB:6wpkA	0.323	0.104	3.972E-1	547	0.116	0.037	6wpkA.pdb.gz
12	PDB:3bs5A	0.337	0.640	5.370E-1	86	0.081	0.163	3bs5A.pdb.gz
13	PDB:6nmiC	0.171	0.090	9.813E-1	408	0.069	0.029	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
14	PDB:3fyhA	0.254	0.154	1.107	296	0.064	0.037	3fyhA.pdb.gz	Crystal structure of an archaeal Rad51 homologue in complex with a metatungstate inhibitor.
15	PDB:5apnh	0.163	0.212	1.793	119	0.127	0.185	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:6tljS	0.172	0.119	2.282	293	0.145	0.085	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
17	PDB:1xu4A	0.254	0.144	2.575	318	0.064	0.035	1xu4A.pdb.gz	Crystal structure of an ATPase-active form of Rad51 homolog from Methanococcus voltae. Insights into potassium dependence
18	PDB:7ej6B	0.229	0.131	3.927	316	0.046	0.025	7ej6B.pdb.gz	Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.
19	PDB:1hbrD	0.193	0.220	4.705	146	0.069	0.082	1hbrD.pdb.gz	The structural and functional analysis of the hemoglobin D component from chicken.
20	PDB:6yxxBS	0.231	0.246	4.705	161	0.046	0.050	6yxxBS.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TGI4	4.65e-127	355	173	1.000	1.000	SAMD5_HUMAN Sterile alpha motif domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SAMD5 PE=1 SV=1
2	Q3V1H9	7.74e-111	314	173	0.896	0.896	SAMD5_MOUSE Sterile alpha motif domain-containing protein 5 OS=Mus musculus OX=10090 GN=Samd5 PE=1 SV=1
3	A0A0B4KH49	5.28e-33	115	128	0.382	0.516	A0A0B4KH49_DROME Shal K[+] channel interacting protein, isoform H OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
4	A0A0B4KHM3	2.03e-29	115	1027	0.387	0.065	A0A0B4KHM3_DROME Shal K[+] channel interacting protein, isoform J OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
5	A0A0B4K6C1	2.08e-29	115	1034	0.387	0.065	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
6	Q0KI30	2.58e-29	115	1064	0.387	0.063	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2
7	A0A0B4KHV7	5.86e-29	114	1080	0.364	0.058	A0A0B4KHV7_DROME Shal K[+] channel interacting protein, isoform I OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
8	Q8SZS0	6.18e-29	114	952	0.364	0.066	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
9	A0A0G2JY48	1.95e-08	55.1	965	0.127	0.023	A0A0G2JY48_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=2
10	B2B9B0	1.99e-08	55.1	986	0.127	0.022	B2B9B0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=2 SV=1
11	F1MAJ0	1.99e-08	55.1	987	0.127	0.022	F1MAJ0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Ephb2 PE=1 SV=4
12	P29323	2.17e-08	54.7	1055	0.127	0.021	EPHB2_HUMAN Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5
13	P54763	2.28e-08	54.7	986	0.127	0.022	EPHB2_MOUSE Ephrin type-B receptor 2 OS=Mus musculus OX=10090 GN=Ephb2 PE=1 SV=3
14	P54761	2.30e-08	54.7	987	0.139	0.024	EPHB4_MOUSE Ephrin type-B receptor 4 OS=Mus musculus OX=10090 GN=Ephb4 PE=1 SV=2
15	W5U6G9	3.29e-08	54.3	1256	0.133	0.018	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
16	Q9WVR3	3.51e-08	54.3	1257	0.133	0.018	SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Inppl1 PE=1 SV=1
17	A0A0C5A9Q6	3.52e-08	54.3	1283	0.133	0.018	A0A0C5A9Q6_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (Fragment) OS=Ictalurus punctatus OX=7998 PE=2 SV=1
18	Q6P549	3.58e-08	54.3	1257	0.133	0.018	SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus OX=10090 GN=Inppl1 PE=1 SV=1
19	O15357	3.79e-08	54.3	1258	0.133	0.018	SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2
20	D7PF45	3.90e-08	53.9	1260	0.133	0.018	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	3.3e-12	58.0	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	4.2e-09	47.7	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321826	0.779	Syntaxin-binding protein 5
2	9606.ENSP00000356437	0.738	SAM and SH3 domain-containing protein 1
3	9606.ENSP00000358902	0.713	Sterile alpha motif domain containing 10
4	9606.ENSP00000480763	0.703	Ephrin type-A receptor 5
5	9606.ENSP00000254770	0.687	LanC-like protein 2
6	9606.ENSP00000391299	0.658	Sterile alpha motif domain-containing protein 7
7	9606.ENSP00000356465	0.644	Ras-related protein Rab-32
8	9606.ENSP00000346414	0.616	Leucine rich repeats and IQ motif containing 3
9	9606.ENSP00000252939	0.610	Neuron-specific vesicular protein calcyon
10	9606.ENSP00000455041	0.609	Transmembrane channel-like protein 7
11	9606.ENSP00000368799	0.597	Kelch repeat and BTB domain containing 6
12	9606.ENSP00000216923	0.546	Zinc finger protein 64 homolog, isoforms 1 and 2
13	9606.ENSP00000317224	0.533	Protein Smaug homolog 2
14	9606.ENSP00000411140	0.507	Nuclear pore complex interacting protein family member B15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.918	biological regulation
GO:0050789	0.900	regulation of biological process
GO:0050794	0.886	regulation of cellular process
GO:0009987	0.599	cellular process
GO:0032501	0.391	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.373	membrane-bounded organelle
GO:0043229	0.372	intracellular organelle
GO:0043231	0.356	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]