StarFunc result for job id Q5TGJ6

User Input

>input (251 residues)
MSAYGMPMYKSGDLVFAKLKGYAHWPARIEHMTQPNRYQVFFFGTHETAFLSPKRLFPYK
ECKEKFGKPNKRRGFSAGLWEIENNPTVQASDCPLASEKGSGDGPWPEPEAAEGDEDKPT
HAGGGGDELGKPDDDKPTEEEKGPLKRSAGDPPEDAPKRPKEAAPDQEEEAEAERAAEAE
RAAAAAAATAVDEESPFLVAVENGSAPSEPGLVCEPPQPEEEELREEEVADEEASQEWHA
EAPGGGDRDSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FVD1	0.328	0.408	7.803E-15	201	0.323	0.403	Q5FVD1.pdb.gz	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
2	AFDB:A0A024R216	0.339	0.418	1.272E-14	203	0.319	0.394	A0A024R216.pdb.gz
3	AFDB:Q7Z4V5	0.345	0.132	4.592E-14	671	0.343	0.128	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
4	AFDB:Q3UMU9	0.351	0.138	1.873E-13	669	0.331	0.124	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
5	PDB:6s01K	0.305	0.833	3.774E-9	86	0.211	0.616	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
6	AFDB:Q49A26	0.336	0.164	1.319E-6	553	0.219	0.099	Q49A26.pdb.gz	GLYR1_HUMAN Cytokine-like nuclear factor N-PAC OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4
7	AFDB:K7EQB2	0.283	0.376	1.491E-6	185	0.191	0.259	K7EQB2.pdb.gz	K7EQB2_HUMAN Glyoxylate reductase 1 homolog (Fragment) OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=8
8	PDB:7e29A	0.243	0.130	1.599E-3	496	0.072	0.036	7e29A.pdb.gz	H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.
9	AFDB:Q57Z69	0.235	0.082	1.901E-3	797	0.112	0.035	Q57Z69.pdb.gz	Q57Z69_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.300 PE=4 SV=1
10	AFDB:Q9BVI0	0.232	0.062	2.580E-3	1012	0.199	0.049	Q9BVI0.pdb.gz	PHF20_HUMAN PHD finger protein 20 OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=2
11	AFDB:Q9FZD9	0.203	0.076	3.099E-3	695	0.143	0.052	Q9FZD9.pdb.gz	DUF3_ARATH DUF724 domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=DUF3 PE=1 SV=1
12	AFDB:Q8BLG0	0.236	0.063	4.207E-3	1010	0.179	0.045	Q8BLG0.pdb.gz	PHF20_MOUSE PHD finger protein 20 OS=Mus musculus OX=10090 GN=Phf20 PE=1 SV=2
13	PDB:4v8mBU	0.199	0.305	3.837E-2	158	0.080	0.127	4v8mBU.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
14	PDB:7f5sLT	0.187	0.287	7.071E-2	159	0.096	0.151	7f5sLT.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
15	PDB:4v6iBN	0.185	0.313	7.516E-2	138	0.040	0.072	4v6iBN.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
16	PDB:7abi7	0.183	0.194	7.990E-2	236	0.028	0.030	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
17	PDB:3p8bB	0.184	0.304	9.598E-2	147	0.028	0.048	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
18	PDB:5aj0AM	0.184	0.320	9.598E-2	139	0.028	0.050	5aj0AM.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
19	PDB:6tedZ	0.174	0.088	9.598E-2	510	0.040	0.020	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
20	PDB:7okyZ	0.175	0.119	1.020E-1	374	0.036	0.024	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51859	6.59e-65	204	237	0.470	0.498	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
2	A0A384NPW1	3.00e-61	194	240	0.494	0.517	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	P51858	3.00e-61	194	240	0.494	0.517	HDGF_HUMAN Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1
4	Q8VHK7	4.72e-61	194	237	0.470	0.498	HDGF_RAT Hepatoma-derived growth factor OS=Rattus norvegicus OX=10116 GN=Hdgf PE=1 SV=2
5	Q9JMG7	2.20e-37	132	202	0.243	0.302	HDGR3_MOUSE Hepatoma-derived growth factor-related protein 3 OS=Mus musculus OX=10090 GN=Hdgfl3 PE=1 SV=2
6	Q9Y3E1	2.26e-37	132	203	0.239	0.296	HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
7	Q7Z4V5	1.42e-36	138	671	0.271	0.101	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
8	Q5FVD1	2.39e-36	129	201	0.235	0.294	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
9	Q3UMU9	1.46e-35	135	669	0.267	0.100	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
10	Q925G1	3.64e-35	134	669	0.235	0.088	HDGR2_RAT Hepatoma-derived growth factor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Hdgfl2 PE=1 SV=2
11	O75475	6.79e-34	130	530	0.247	0.117	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
12	Q812D1	7.09e-34	129	528	0.243	0.116	PSIP1_RAT PC4 and SFRS1-interacting protein OS=Rattus norvegicus OX=10116 GN=Psip1 PE=1 SV=1
13	Q5XXA9	2.48e-33	129	579	0.251	0.109	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
14	Q99JF8	4.29e-33	127	528	0.219	0.104	PSIP1_MOUSE PC4 and SFRS1-interacting protein OS=Mus musculus OX=10090 GN=Psip1 PE=1 SV=1
15	H3BPM9	1.06e-05	46.2	141	0.072	0.128	H3BPM9_HUMAN HDGF like 3 (Fragment) OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
16	Q9XER9	1.59e-05	48.1	1392	0.092	0.017	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
17	Q9LEY4	1.07e-04	45.4	1445	0.096	0.017	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
18	F4IZM8	2.02e-04	44.7	1347	0.080	0.015	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
19	Q8T079	2.42e-04	44.3	602	0.108	0.045	GLYR1_DROME Cytokine-like nuclear factor N-PAC OS=Drosophila melanogaster OX=7227 GN=Ndf PE=1 SV=1
20	Q96N64	3.42e-04	43.9	755	0.100	0.033	PWP2A_HUMAN PWWP domain-containing protein 2A OS=Homo sapiens OX=9606 GN=PWWP2A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00855 PWWP	1e-05	37.2	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306324	0.681	PWWP domain containing 2B
2	9606.ENSP00000334300	0.672	Actin-like protein 7A
3	9606.ENSP00000325002	0.660	Coatomer subunit gamma-1
4	9606.ENSP00000373696	0.653	E3 ubiquitin-protein ligase TRIP12
5	9606.ENSP00000372351	0.639	Histone-lysine N-methyltransferase NSD2
6	9606.ENSP00000341422	0.634	Transmembrane prolyl 4-hydroxylase
7	9606.ENSP00000252744	0.611	Zinc finger SWIM-type containing 6
8	9606.ENSP00000369531	0.607	Ubiquilin-like protein
9	9606.ENSP00000402346	0.599	Coatomer subunit gamma-2
10	9606.ENSP00000313983	0.592	Histone-lysine N-methyltransferase NSD3
11	9606.ENSP00000313691	0.586	Ferritin, mitochondrial
12	9606.ENSP00000280605	0.531	Transketolase-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.970	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0010468	0.983	regulation of gene expression
GO:0009987	0.967	cellular process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0019219	0.937	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.913	regulation of RNA metabolic process
GO:0010556	0.854	regulation of macromolecule biosynthetic process
GO:0048518	0.845	positive regulation of biological process
GO:2001141	0.719	regulation of RNA biosynthetic process
GO:1903506	0.713	regulation of nucleic acid-templated transcription
GO:0048522	0.611	positive regulation of cellular process
GO:0048523	0.582	negative regulation of cellular process
GO:0006355	0.548	regulation of DNA-templated transcription
GO:0050896	0.373	response to stimulus
GO:0009893	0.323	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.986	protein-containing complex
GO:0005654	0.985	nucleoplasm
GO:0005737	0.655	cytoplasm
GO:0043232	0.583	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]