StarFunc result for job id Q5TGS1

User Input

>input (186 residues)
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVP
RGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPC
TPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGS
PGDDLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61657	0.460	0.484	1.792E-14	175	0.645	0.686	Q61657.pdb.gz	HES3_MOUSE Transcription factor HES-3 OS=Mus musculus OX=10090 GN=Hes3 PE=2 SV=2
2	AFDB:Q04667	0.356	0.376	1.337E-13	175	0.613	0.651	Q04667.pdb.gz	HES3_RAT Transcription factor HES-3 OS=Rattus norvegicus OX=10116 GN=Hes3 PE=2 SV=1
3	AFDB:Q9SGQ0	0.118	0.053	2.057E-1	486	0.151	0.058	Q9SGQ0.pdb.gz	VOZ1_ARATH Transcription factor VOZ1 OS=Arabidopsis thaliana OX=3702 GN=VOZ1 PE=1 SV=1
4	AFDB:O18374	0.218	0.175	2.689E-1	242	0.194	0.149	O18374.pdb.gz	O18374_DROME BHLH protein OS=Drosophila melanogaster OX=7227 GN=HLH54F PE=2 SV=1
5	PDB:5apnh	0.131	0.189	3.117E-1	119	0.086	0.134	5apnh.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
6	AFDB:Q0VG99	0.265	0.130	3.288E-1	397	0.215	0.101	Q0VG99.pdb.gz	MESP2_HUMAN Mesoderm posterior protein 2 OS=Homo sapiens OX=9606 GN=MESP2 PE=1 SV=2
7	AFDB:Q6AT90	0.232	0.091	3.288E-1	505	0.231	0.085	Q6AT90.pdb.gz	APG_ORYSJ Transcription factor APG OS=Oryza sativa subsp. japonica OX=39947 GN=APG PE=1 SV=1
8	AFDB:Q9FUA4	0.251	0.132	4.914E-1	373	0.199	0.099	Q9FUA4.pdb.gz	SPT_ARATH Transcription factor SPATULA OS=Arabidopsis thaliana OX=3702 GN=SPT PE=1 SV=1
9	AFDB:M9NEC7	0.144	0.047	5.618E-1	698	0.194	0.052	M9NEC7.pdb.gz	M9NEC7_DROME Hyperkinetic, isoform F OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
10	AFDB:Q9NQ87	0.213	0.126	6.423E-1	328	0.339	0.192	Q9NQ87.pdb.gz	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
11	AFDB:Q0D311	0.251	0.120	7.344E-1	403	0.237	0.109	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
12	PDB:4v6wCh	0.125	0.171	3.250	123	0.075	0.114	4v6wCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:3wqyA	0.104	0.038	3.475	905	0.113	0.023	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
14	PDB:7r5sS	0.180	0.260	3.715	120	0.043	0.067	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
15	PDB:7ktrE	0.152	0.205	4.248	124	0.054	0.081	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
16	PDB:3vh5A	0.187	0.312	5.553	100	0.038	0.070	3vh5A.pdb.gz
17	PDB:4v60A	0.131	0.043	5.553	812	0.091	0.021	4v60A.pdb.gz
18	PDB:7lbmd	0.125	0.090	5.553	275	0.086	0.058	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:6v8oO	0.123	0.070	5.938	384	0.059	0.029	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
20	PDB:7edxl	0.163	0.239	5.938	107	0.054	0.093	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q61657	1.06e-69	211	175	0.645	0.686	HES3_MOUSE Transcription factor HES-3 OS=Mus musculus OX=10090 GN=Hes3 PE=2 SV=2
2	Q04667	1.60e-65	200	175	0.629	0.669	HES3_RAT Transcription factor HES-3 OS=Rattus norvegicus OX=10116 GN=Hes3 PE=2 SV=1
3	Q90465	2.76e-26	102	229	0.285	0.231	Q90465_DANRE HER-3 protein OS=Danio rerio OX=7955 GN=HER-3 PE=2 SV=1
4	Q6IRB2	1.24e-13	69.3	267	0.312	0.217	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
5	Q04666	9.81e-13	67.0	281	0.263	0.174	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1
6	Q6PBX3	6.69e-12	64.3	270	0.231	0.159	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
7	Q14469	6.76e-12	64.7	280	0.220	0.146	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
8	Q9DF41	9.55e-12	64.3	291	0.296	0.189	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
9	P35428	1.00e-11	63.9	282	0.220	0.145	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
10	Q90VV1	1.83e-11	63.2	277	0.220	0.148	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
11	Q6XLQ0	2.11e-11	63.2	290	0.220	0.141	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
12	O57337	2.94e-11	62.8	290	0.220	0.141	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
13	Q26263	4.17e-11	62.8	435	0.204	0.087	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
14	Q90Z12	4.92e-11	62.0	281	0.220	0.146	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
15	Q9HCC6	7.86e-11	60.8	221	0.231	0.195	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
16	Q03062	2.85e-10	58.5	166	0.172	0.193	HES5_RAT Transcription factor HES-5 OS=Rattus norvegicus OX=10116 GN=Hes5 PE=2 SV=1
17	Q5TA89	1.01e-09	57.0	166	0.172	0.193	HES5_HUMAN Transcription factor HES-5 OS=Homo sapiens OX=9606 GN=HES5 PE=2 SV=1
18	Q7T3J0	1.99e-09	55.8	149	0.199	0.248	Q7T3J0_DANRE Hairy and enhancer of split 5 OS=Danio rerio OX=7955 GN=hes5 PE=2 SV=1
19	P70120	2.22e-09	56.2	167	0.172	0.192	HES5_MOUSE Transcription factor HES-5 OS=Mus musculus OX=10090 GN=Hes5 PE=1 SV=1
20	F1QI81	4.32e-09	56.2	221	0.204	0.172	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	3.3e-09	47.9	Helix-loop-helix DNA-binding domain
2	PF00157 Pou	4.6e+02	12.2	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.586	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000341988	0.586	Spermatogenesis-associated protein 31D1
3	9606.ENSP00000429073	0.586	Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3
4	9606.ENSP00000338272	0.579	Hairy/enhancer-of-split related with YRPW motif protein 1
5	9606.ENSP00000361943	0.579	Hairy/enhancer-of-split related with YRPW motif-like protein
6	9606.ENSP00000262487	0.571	Isthmin-1
7	9606.ENSP00000414517	0.559	Mastermind-like domain-containing protein 1
8	9606.ENSP00000272937	0.557	Transcription cofactor HES-6
9	9606.ENSP00000259915	0.521	POU domain, class 5, transcription factor 1
10	9606.ENSP00000252891	0.517	Numb-like protein
11	9606.ENSP00000442439	0.513	Homeobox protein MIXL1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.996	protein binding
GO:0001227	0.987	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.985	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.326	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.997	regulation of gene expression
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0048519	0.983	negative regulation of biological process
GO:0048523	0.974	negative regulation of cellular process
GO:0048856	0.970	anatomical structure development
GO:0032501	0.966	multicellular organismal process
GO:0007275	0.951	multicellular organism development
GO:0009892	0.914	negative regulation of metabolic process
GO:0010605	0.904	negative regulation of macromolecule metabolic process
GO:0031327	0.885	negative regulation of cellular biosynthetic process
GO:0010558	0.884	negative regulation of macromolecule biosynthetic process
GO:0051172	0.879	negative regulation of nitrogen compound metabolic process
GO:0048731	0.871	system development
GO:0045892	0.867	negative regulation of DNA-templated transcription
GO:0048518	0.650	positive regulation of biological process
GO:0009987	0.561	cellular process
GO:0048522	0.497	positive regulation of cellular process
GO:0006357	0.490	regulation of transcription by RNA polymerase II
GO:0050896	0.417	response to stimulus
GO:0048513	0.403	animal organ development
GO:0009893	0.355	positive regulation of metabolic process
GO:0010604	0.330	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.888	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]