StarFunc result for job id Q5TGU0

User Input

>input (170 residues)
MRLQGAIFVLLPHLGPILVWLFTRDHMSGWCEGPRMLSWCPFYKVLLLVQTAIYSVVGYA
SYLVWKDLGGGLGWPLALPLGLYAVQLTISWTVLVLFFTVHNPGLALLHLLLLYGLVVST
ALIWHPINKLAALLLLPYLAWLTVTSALTYHLWRDSLCPVHQPQPTEKSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TGU0	1.000	1.000	1.294E-23	170	1.000	1.000	Q5TGU0.pdb.gz	TSPO2_HUMAN Translocator protein 2 OS=Homo sapiens OX=9606 GN=TSPO2 PE=1 SV=1
2	AFDB:E2RDM9	0.899	0.889	3.490E-16	172	0.712	0.703	E2RDM9.pdb.gz	TSPO2_CANLF Translocator protein 2 OS=Canis lupus familiaris OX=9615 GN=TSPO2 PE=1 SV=1
3	AFDB:Q9CRZ8	0.788	0.824	1.261E-13	162	0.653	0.685	Q9CRZ8.pdb.gz	TSPO2_MOUSE Translocator protein 2 OS=Mus musculus OX=10090 GN=Tspo2 PE=2 SV=2
4	AFDB:Q5XJB6	0.787	0.823	5.665E-9	162	0.376	0.395	Q5XJB6.pdb.gz	Q5XJB6_DANRE Translocator protein OS=Danio rerio OX=7955 GN=zgc:103456 PE=1 SV=1
5	AFDB:Q9VPR1	0.764	0.707	5.565E-8	185	0.347	0.319	Q9VPR1.pdb.gz	Q9VPR1_DROME GH02075p OS=Drosophila melanogaster OX=7227 GN=Tspo PE=1 SV=1
6	AFDB:P30536	0.801	0.805	5.854E-8	169	0.376	0.379	P30536.pdb.gz	TSPO_HUMAN Translocator protein OS=Homo sapiens OX=9606 GN=TSPO PE=1 SV=3
7	AFDB:P16257	0.707	0.711	9.727E-8	169	0.341	0.343	P16257.pdb.gz	TSPO_RAT Translocator protein OS=Rattus norvegicus OX=10116 GN=Tspo PE=1 SV=1
8	PDB:2mgyA	0.648	0.651	1.464E-5	169	0.353	0.355	2mgyA.pdb.gz	Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.
9	AFDB:O94327	0.617	0.637	1.456E-4	164	0.247	0.256	O94327.pdb.gz	TSPO_SCHPO Translocator protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC725.10 PE=3 SV=2
10	AFDB:Q8KBX2	0.674	0.722	2.077E-4	158	0.229	0.247	Q8KBX2.pdb.gz	TSPO_CHLTE Tryptophan-rich protein TspO OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=crtK-2 PE=1 SV=1
11	PDB:4rynA	0.689	0.751	3.081E-4	154	0.141	0.156	4rynA.pdb.gz	Protein structure. Structure and activity of tryptophan-rich TSPO proteins.
12	PDB:5duoA	0.654	0.703	3.775E-4	157	0.224	0.242	5duoA.pdb.gz	Response to Comment on "Crystal structures of translocator protein (TSPO) and mutant mimic of a human polymorphism".
13	AFDB:Q9RFC8	0.710	0.757	4.681E-4	158	0.206	0.222	Q9RFC8.pdb.gz	TSPO_CERSP Tryptophan-rich sensory protein OS=Cereibacter sphaeroides OX=1063 GN=tspO PE=1 SV=1
14	PDB:7eebM	0.347	0.483	1.150	116	0.076	0.112	7eebM.pdb.gz	Structure of a mammalian sperm cation channel complex.
15	PDB:3egwC	0.247	0.200	1.339	225	0.153	0.116	3egwC.pdb.gz	When width is more important than height: Barriers to electron transfer in E.coli nitrate reductase
16	PDB:7o6eA	0.325	0.313	1.409	177	0.135	0.130	7o6eA.pdb.gz
17	PDB:7khsA	0.229	0.108	1.641	449	0.112	0.042	7khsA.pdb.gz	Diazaspirononane Nonsaccharide Inhibitors of O-GlcNAcase (OGA) for the Treatment of Neurodegenerative Disorders.
18	PDB:2ix6A	0.433	0.213	2.592	416	0.159	0.065	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
19	PDB:4cadI	0.250	0.189	2.869	254	0.141	0.094	4cadI.pdb.gz
20	PDB:3pblA	0.185	0.093	3.175	432	0.124	0.049	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TGU0	1.99e-118	333	170	1.000	1.000	TSPO2_HUMAN Translocator protein 2 OS=Homo sapiens OX=9606 GN=TSPO2 PE=1 SV=1
2	E2RDM9	4.29e-68	206	172	0.729	0.721	TSPO2_CANLF Translocator protein 2 OS=Canis lupus familiaris OX=9615 GN=TSPO2 PE=1 SV=1
3	Q9CRZ8	1.84e-51	164	162	0.653	0.685	TSPO2_MOUSE Translocator protein 2 OS=Mus musculus OX=10090 GN=Tspo2 PE=2 SV=2
4	Q5XJB6	5.61e-33	117	162	0.371	0.389	Q5XJB6_DANRE Translocator protein OS=Danio rerio OX=7955 GN=zgc:103456 PE=1 SV=1
5	Q9VPR1	8.23e-28	104	185	0.341	0.314	Q9VPR1_DROME GH02075p OS=Drosophila melanogaster OX=7227 GN=Tspo PE=1 SV=1
6	P30536	6.35e-27	101	169	0.371	0.373	TSPO_HUMAN Translocator protein OS=Homo sapiens OX=9606 GN=TSPO PE=1 SV=3
7	P50637	5.91e-26	99.0	169	0.347	0.349	TSPO_MOUSE Translocator protein OS=Mus musculus OX=10090 GN=Tspo PE=1 SV=1
8	P16257	7.33e-26	99.0	169	0.347	0.349	TSPO_RAT Translocator protein OS=Rattus norvegicus OX=10116 GN=Tspo PE=1 SV=1
9	O76068	2.81e-25	96.7	143	0.335	0.399	O76068_HUMAN Peripheral-type benzodiazepine receptor (Fragment) OS=Homo sapiens OX=9606 GN=PBR PE=2 SV=1
10	B1AH87	1.01e-09	55.1	107	0.224	0.355	B1AH87_HUMAN Translocator protein (Fragment) OS=Homo sapiens OX=9606 GN=TSPO PE=1 SV=1
11	O94327	1.55e-04	42.4	164	0.218	0.226	TSPO_SCHPO Translocator protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC725.10 PE=3 SV=2
12	Q8KBX2	4.89e-04	40.8	158	0.141	0.152	TSPO_CHLTE Tryptophan-rich protein TspO OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=crtK-2 PE=1 SV=1
13	O28797	0.003	38.5	153	0.206	0.229	TSPO_ARCFU Tryptophan-rich protein TspO OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=tspO PE=3 SV=1
14	Q9RFC8	0.018	36.2	158	0.176	0.190	TSPO_CERSP Tryptophan-rich sensory protein OS=Cereibacter sphaeroides OX=1063 GN=tspO PE=1 SV=1
15	Q91WW5	4.8	29.6	304	0.129	0.072	MRGA1_MOUSE Mas-related G-protein coupled receptor member A1 OS=Mus musculus OX=10090 GN=Mrgpra1 PE=2 SV=1
16	A0A1D8PKY2	5.1	30.0	554	0.159	0.049	A0A1D8PKY2_CANAL Frp1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FRP1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03073 TspO_MBR	4.9e-27	106.0	TspO/MBR family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276449	0.731	Steroidogenic acute regulatory protein, mitochondrial
2	9606.ENSP00000381266	0.694	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4
3	9606.ENSP00000252505	0.690	Probable allantoicase
4	9606.ENSP00000415430	0.690	G2 and S phase-expressed protein 1
5	9606.ENSP00000201586	0.660	Sulfotransferase family cytosolic 2B member 1
6	9606.ENSP00000263702	0.646	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
7	9606.ENSP00000264029	0.646	Trehalase
8	9606.ENSP00000262265	0.609	PIH1 domain-containing protein 1
9	9606.ENSP00000201647	0.543	Epidermal growth factor receptor kinase substrate 8-like protein 1
10	9606.ENSP00000337358	0.541	Haloacid dehalogenase-like hydrolase domain-containing 5
11	9606.ENSP00000241052	0.523	Catalase
12	9606.ENSP00000254250	0.502	THAP domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901702	0.999	salt transmembrane transporter activity
GO:0015101	0.999	organic cation transmembrane transporter activity
GO:0015171	0.999	amino acid transmembrane transporter activity
GO:0008028	0.999	monocarboxylic acid transmembrane transporter activity
GO:0097159	0.950	organic cyclic compound binding
GO:1901363	0.829	heterocyclic compound binding
GO:0140485	0.403	5-aminolevulinic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071702	0.995	organic substance transport
GO:0050789	0.415	regulation of biological process
GO:0071704	0.387	organic substance metabolic process
GO:0055085	0.305	transmembrane transport
GO:0071705	0.302	nitrogen compound transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043227	1.000	membrane-bounded organelle
GO:0043231	0.979	intracellular membrane-bounded organelle
GO:0005886	0.976	plasma membrane
GO:0005737	0.965	cytoplasm
GO:0031090	0.904	organelle membrane
GO:0012505	0.585	endomembrane system
GO:0005634	0.315	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:64816	0.403	5-aminolevulinate(in) = 5-aminolevulinate(out)

[back to server]