StarFunc result for job id Q5TGY3

User Input

>input (1603 residues)
MRVKPQGLVVTSSAVCSSPDYLREPKYYPGGPPTPRPLLPTRPPASPPDKAFSTHAFSEN
PRPPPRRDPSTRRPPVLAKGDDPLPPRAARPVSQARCPTPVGDGSSSRRCWDNGRVNLRP
VVQLIDIMKDLTRLSQDLQHSGVHLDCGGLRLSRPPAPPPGDLQYSFFSSPSLANSIRSP
EERATPHAKSERPSHPLYEPEPEPRDSPQPGQGHSPGATAAATGLPPEPEPDSTDYSELA
DADILSELASLTCPEAQLLEAQALEPPSPEPEPQLLDPQPRFLDPQALEPLGEALELPPL
QPLADPLGLPGLALQALDTLPDSLESQLLDPQALDPLPKLLDVPGRRLEPQQPLGHCPLA
EPLRLDLCSPHGPPGPEGHPKYALRRTDRPKILCRRRKAGRGRKADAGPEGRLLPLPMPT
GLVAALAEPPPPPPPPPPALPGPGPVSVPELKPESSQTPVVSTRKGKCRGVRRMVVKMAK
IPVSLGRRNKTTYKVSSLSSSLSVEGKELGLRVSAEPTPLLKMKNNGRNVVVVFPPGEMP
IILKRKRGRPPKNLLLGPGKPKEPAVVAAEAATVAAATMAMPEVKKRRRRKQKLASPQPS
YAADANDSKAEYSDVLAKLAFLNRQSQCAGRCSPPRCWTPSEPESVHQAPDTQSISHFLH
RVQGFRRRGGKAGGFGGRGGGHAAKSARCSFSDFFEGIGKKKKVVAVAAAGVGGPGLTEL
GHPRKRGRGEVDAVTGKPKRKRRSRKNGTLFPEQVPSGPGFGEAGAEWAGDKGGGWAPHH
GHPGGQAGRNCGFQGTEARAFASTGLESGASGRGSYYSTGAPSGQTELSQERQNLFTGYF
RSLLDSDDSSDLLDFALSASRPESRKASGTYAGPPTSALPAQRGLATFPSRGAKASPVAV
GSSGAGADPSFQPVLSARQTFPPGRAASYGLTPAASDCRAAETFPKLVPPPSAMARSPTT
HPPANTYLPQYGGYGAGQSVFAPTKPFTGQDCANSKDCSFAYGSGNSLPASPSSAHSAGY
APPPTGGPCLPPSKASFFSSSEGAPFSGSAPTPLRCDSRASTVSPGGYMVPKGTTASATS
AASAASSSSSSFQPSPENCRQFAGASQWPFRQGYGGLDWASEAFSQLYNPSFDCHVSEPN
VILDISNYTPQKVKQQTAVSETFSESSSDSTQFNQPVGGGGFRRANSEASSSEGQSSLSS
LEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGY
PSKRSTGPRQPRGGRGGGACSAKKERGGAAAKAKFIPKPQPVNPLFQDSPDLGLDYYSGD
SSMSPLPSQSRAFGVGERDPCDFIGPYSMNPSTPSDGTFGQGFHCDSPSLGAPELDGKHF
PPLAHPPTVFDAGLQKAYSPTCSPTLGFKEELRPPPTKLAACEPLKHGLQGASLGHAAAA
QAHLSCRDLPLGQPHYDSPSCKGTAYWYPPGSAARSPPYEGKVGTGLLADFLGRTEAACL
SAPHLASPPATPKADKEPLEMARPPGPPRGPAAAAAGYGCPLLSDLTLSPVPRDSLLPLQ
DTAYRYPGFMPQAHPGLGGGPKSGFLGPMAEPHPEDTFTVTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TGY3	0.999	0.999	0.000	1603	1.000	1.000	Q5TGY3.pdb.gz	AHDC1_HUMAN Transcription factor Gibbin OS=Homo sapiens OX=9606 GN=AHDC1 PE=1 SV=1
2	AFDB:F4I1T7	0.028	0.026	5.656E-4	1819	0.133	0.117	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
3	AFDB:Q9VT00	0.039	0.031	1.717E-3	2351	0.172	0.117	Q9VT00.pdb.gz	Q9VT00_DROME Jumonji, AT rich interactive domain 2 OS=Drosophila melanogaster OX=7227 GN=Jarid2 PE=1 SV=3
4	AFDB:Q86UU0	0.041	0.043	2.380E-3	1499	0.147	0.157	Q86UU0.pdb.gz	BCL9L_HUMAN B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1
5	AFDB:P21263	0.031	0.028	4.013E-3	1893	0.143	0.121	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
6	AFDB:F1R405	0.033	0.033	4.573E-3	1573	0.173	0.177	F1R405.pdb.gz	F1R405_DANRE B-cell CLL/lymphoma 9 protein isoform X1 OS=Danio rerio OX=7955 GN=si:ch73-15j19.1 PE=1 SV=1
7	AFDB:D3ZGX1	0.037	0.038	5.211E-3	1517	0.152	0.160	D3ZGX1.pdb.gz	NEXMI_RAT Neurite extension and migration factor OS=Rattus norvegicus OX=10116 GN=Nexmif PE=1 SV=1
8	AFDB:Q6P5H2	0.036	0.033	6.767E-3	1864	0.137	0.117	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
9	AFDB:Q09904	0.032	0.038	7.712E-3	1159	0.114	0.158	Q09904.pdb.gz	NU124_SCHPO Nucleoporin nup124 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup124 PE=1 SV=1
10	AFDB:Q5QGS0	0.038	0.039	1.300E-2	1516	0.140	0.148	Q5QGS0.pdb.gz	NEXMI_HUMAN Neurite extension and migration factor OS=Homo sapiens OX=9606 GN=NEXMIF PE=1 SV=1
11	PDB:2lgcA	0.014	0.060	3.337	359	0.003	0.014	2lgcA.pdb.gz
12	PDB:7zq6u	0.014	0.181	4.938	91	0.002	0.033	7zq6u.pdb.gz	Modulating co-translational protein folding by rational design and ribosome engineering.
13	PDB:5glhA	0.010	0.036	5.627	452	0.001	0.004	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
14	PDB:5ondA	0.011	0.112	6.845	135	0.003	0.037	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
15	PDB:2v4jB	0.013	0.048	7.800	380	0.002	0.011	2v4jB.pdb.gz	The Crystal Structure of Desulfovibrio Vulgaris Dissimilatory Sulfite Reductase Bound to Dsrc Provides Novel Insights Into the Mechanism of Sulfate Respiration.
16	PDB:3cphA	0.010	0.089	8.327	175	0.002	0.017	3cphA.pdb.gz	A structural model of the GDP dissociation inhibitor rab membrane extraction mechanism.
17	PDB:3upuA	0.009	0.034	8.327	439	0.002	0.007	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
18	PDB:5c0wJ	0.011	0.018	8.327	970	0.002	0.003	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:6z3eA	0.013	0.070	8.327	237	0.005	0.034	6z3eA.pdb.gz	Crystal structure of GDP-bound human GIMAP5
20	PDB:7ac7U	0.014	0.161	8.327	103	0.002	0.029	7ac7U.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TGY3	0.0	3184	1603	1.000	1.000	AHDC1_HUMAN Transcription factor Gibbin OS=Homo sapiens OX=9606 GN=AHDC1 PE=1 SV=1
2	Q6PAL7	0.0	2551	1594	0.943	0.949	AHDC1_MOUSE Transcription factor Gibbin OS=Mus musculus OX=10090 GN=Ahdc1 PE=1 SV=1
3	O60673	3.74e-07	57.8	3130	0.032	0.017	REV3L_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=2
4	Q61493	6.14e-07	57.0	3122	0.017	0.009	REV3L_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus OX=10090 GN=Rev3l PE=1 SV=3
5	Q54VJ6	3.3	34.7	462	0.016	0.054	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15735 DUF4683	1.6e-08	46.3	Domain of unknown function (DUF4683)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363123

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377060	0.667	Chromobox protein homolog 1
2	9606.ENSP00000209875	0.634	Chromobox protein homolog 5
3	9606.ENSP00000262288	0.617	Retinoid-inducible serine carboxypeptidase
4	9606.ENSP00000400972	0.604	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6
5	9606.ENSP00000350704	0.507	Uncharacterized protein C1orf109

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0140585	1.000	promoter-enhancer loop anchoring activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.979	multicellular organismal process
GO:0048856	0.979	anatomical structure development
GO:0007275	0.676	multicellular organism development
GO:0048332	0.670	mesoderm morphogenesis
GO:0001707	0.659	mesoderm formation
GO:0043588	0.556	skin development
GO:0009987	0.425	cellular process
GO:0009887	0.419	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.950	nucleoplasm
GO:0005737	0.672	cytoplasm
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]