StarFunc result for job id Q5TH69

User Input

>input (2177 residues)
MEEILRKLQKEASGSKYKAIKESCTWALETLGGLDTIVKIPPHVLREKCLLPLQLALESK
NVKLAQHALAGMQKLLSEERFVSMETDSDEKQLLNQILNAVKVTPSLNEDLQVEVMKVLL
CITYTPTFDLNGSAVLKIAEVCIETYISSCHQRSINTAVRATLSQMLSDLTLQLRQRQEN
TIIENPDVPQDFGNQGSTVESLCDDVVSVLTVLCEKLQAAINDSQQLQLLYLECILSVLS
SSSSSMHLHRRFTDLIWKNLCPALIVILGNPIHDKTITSAHTSSTSTSLESDSASPGVSD
HGRGSGCSCTAPALSGPVARTIYYIAAELVRLVGSVDSMKPVLQSLYHRVLLYPPPQHRV
EAIKIMKEILGSPQRLCDLAGPSSTESESRKRSISKRKSHLDLLKLIMDGMTEACIKGGI
EACYAAVSCVCTLLGALDELSQGKGLSEGQVQLLLLRLEELKDGAEWSRDSMEINEADFR
WQRRVLSSEHTPWESGNERSLDISISVTTDTGQTTLEGELGQTTPEDHSGNHKNSLKSPA
IPEGKETLSKVLETEAVDQPDVVQRSHTVPYPDITNFLSVDCRTRSYGSRYSESNFSVDD
QDLSRTEFDSCDQYSMAAEKDSGRSDVSDIGSDNCSLADEEQTPRDCLGHRSLRTAALSL
KLLKNQEADQHSARLFIQSLEGLLPRLLSLSNVEEVDTALQNFASTFCSGMMHSPGFDGN
SSLSFQMLMNADSLYTAAHCALLLNLKLSHGDYYRKRPTLAPGVMKDFMKQVQTSGVLMV
FSQAWIEELYHQVLDRNMLGEAGYWGSPEDNSLPLITMLTDIDGLESSAIGGQLMASAAT
ESPFAQSRRIDDSTVAGVAFARYILVGCWKNLIDTLSTPLTGRMAGSSKGLAFILGAEGI
KEQNQKERDAICMSLDGLRKAARLSCALGVAANCASALAQMAAASCVQEEKEEREAQEPS
DAITQVKLKVEQKLEQIGKVQGVWLHTAHVLCMEAILSVGLEMGSHNPDCWPHVFRVCEY
VGTLEHNHFSDGASQPPLTISQPQKATGSAGLLGDPECEGSPPEHSPEQGRSLSTAPVVQ
PLSIQDLVREGSRGRASDFRGGSLMSGSSAAKVVLTLSTQADRLFEDATDKLNLMALGGF
LYQLKKASQSQLFHSVTDTVDYSLAMPGEVKSTQDRKSALHLFRLGNAMLRIVRSKARPL
LHVMRCWSLVAPHLVEAACHKERHVSQKAVSFIHDILTEVLTDWNEPPHFHFNEALFRPF
ERIMQLELCDEDVQDQVVTSIGELVEVCSTQIQSGWRPLFSALETVHGGNKSEMKEYLVG
DYSMGKGQAPVFDVFEAFLNTDNIQVFANAATSYIMCLMKFVKGLGEVDCKEIGDCAPAP
GAPSTDLCLPALDYLRRCSQLLAKIYKMPLKPIFLSGRLAGLPRRLQEQSASSEDGIESV
LSDFDDDTGLIEVWIILLEQLTAAVSNCPRQHQPPTLDLLFELLRDVTKTPGPGFGIYAV
VHLLLPVMSVWLRRSHKDHSYWDMASANFKHAIGLSCELVVEHIQSFLHSDIRYESMINT
MLKDLFELLVACVAKPTETISRVGCSCIRYVLVTAGPVFTEEMWRLACCALQDAFSATLK
PVKDLLGCFHSGTESFSGEGCQVRVAAPSSSPSAEAEYWRIRAMAQQVFMLDTQCSPKTP
NNFDHAQSCQLIIELPPDEKPNGHTKKSVSFREIVVSLLSHQVLLQNLYDILLEEFVKGP
SPGEEKTIQVPEAKLAGFLRYISMQNLAVIFDLLLDSYRTAREFDTSPGLKCLLKKVSGI
GGAANLYRQSAMSFNIYFHALVCAVLTNQETITAEQVKKVLFEDDERSTDSSQQCSSEDE
DIFEETAQVSPPRGKEKRQWRARMPLLSVQPVSNADWVWLVKRLHKLCMELCNNYIQMHL
DLENCMEEPPIFKGDPFFILPSFQSESSTPSTGGFSGKETPSEDDRSQSREHMGESLSLK
AGGGDLLLPPSPKVEKKDPSRKKEWWENAGNKIYTMAADKTISKLMTEYKKRKQQHNLSA
FPKEVKVEKKGEPLGPRGQDSPLLQRPQHLMDQGQMRHSFSAGPELLRQDKRPRSGSTGS
SLSVSVRDAEAQIQAWTNMVLTVLNQIQILPDQTFTALQPAVFPCISQLTCHVTDIRVRQ
AVREWLGRVGRVYDIIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11075	0.283	0.302	1.287E-25	2009	0.129	0.140	P11075.pdb.gz	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
2	PDB:7ni5A	0.074	0.067	5.057E-8	2791	0.102	0.080	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
3	PDB:7sicA	0.080	0.073	1.567E-7	2773	0.102	0.080	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
4	PDB:7mqaLM	0.096	0.099	3.373E-7	2041	0.093	0.099	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7jq9A	0.083	0.077	4.684E-7	2427	0.079	0.070	7jq9A.pdb.gz
6	PDB:7mq8LM	0.100	0.106	6.047E-7	2005	0.099	0.108	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7mq8SP	0.073	0.078	6.747E-7	1993	0.103	0.113	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7su3A	0.102	0.071	7.258E-7	3802	0.107	0.062	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
9	AFDB:Q7Z460	0.058	0.072	1.038E-6	1538	0.093	0.131	Q7Z460.pdb.gz	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
10	PDB:7otmA	0.090	0.061	1.400E-6	3656	0.102	0.060	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
11	PDB:7sx3D	0.111	0.149	1.562E-6	1418	0.078	0.119	7sx3D.pdb.gz	Structural architecture of the human NALCN channelosome.
12	PDB:6zwmB	0.070	0.070	1.742E-6	2185	0.085	0.085	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
13	AFDB:P27732	0.061	0.061	2.863E-4	2203	0.113	0.112	P27732.pdb.gz	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
14	AFDB:A1Z987	0.084	0.114	8.557E-4	1351	0.078	0.126	A1Z987.pdb.gz	A1Z987_DROME Chromosome associated protein G, isoform F OS=Drosophila melanogaster OX=7227 GN=Cap-G PE=1 SV=2
15	AFDB:P15389	0.052	0.054	1.326E-3	2019	0.103	0.111	P15389.pdb.gz	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
16	AFDB:Q57W11	0.051	0.057	1.650E-3	1689	0.111	0.143	Q57W11.pdb.gz	Q57W11_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.390 PE=4 SV=1
17	AFDB:F4IAT2	0.071	0.080	6.367E-3	1823	0.087	0.104	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
18	AFDB:Q9NZN5	0.045	0.053	6.849E-3	1544	0.097	0.137	Q9NZN5.pdb.gz	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
19	AFDB:G5E870	0.085	0.089	9.866E-3	2025	0.089	0.095	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
20	AFDB:Q304E5	0.053	0.107	1.474E-2	771	0.053	0.149	Q304E5.pdb.gz	Q304E5_CAEEL Guanyl-specific ribonuclease pgl-1 OS=Caenorhabditis elegans OX=6239 GN=pgl-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A631	3.83e-22	107	1846	0.079	0.093	BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgef1 PE=1 SV=1
2	E7FCG1	1.88e-21	105	1846	0.063	0.075	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
3	Q9Y6D6	1.70e-20	102	1849	0.075	0.089	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
4	Q7TSU1	1.54e-18	95.9	1791	0.044	0.054	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
5	Q9Y6D5	3.46e-18	94.7	1785	0.062	0.075	BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3
6	Q9VJW1	1.86e-16	89.0	1653	0.042	0.056	Q9VJW1_DROME LD29171p OS=Drosophila melanogaster OX=7227 GN=Sec71 PE=1 SV=2
7	F4JSZ5	1.39e-12	76.3	1687	0.085	0.109	BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana OX=3702 GN=BIG1 PE=2 SV=1
8	F4JN05	6.08e-06	54.3	1706	0.088	0.113	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
9	F4IXW2	8.90e-06	53.9	1739	0.044	0.055	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
10	Q9UT02	3.25e-04	48.5	1811	0.011	0.014	SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec71 PE=1 SV=1
11	Q9LPC5	4.20e-04	48.1	1750	0.032	0.040	BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana OX=3702 GN=BIG3 PE=1 SV=1
12	Q9LZX8	0.003	45.4	1793	0.056	0.068	BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana OX=3702 GN=BIG2 PE=2 SV=1
13	P11075	0.009	43.9	2009	0.013	0.014	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
14	Q9P7V5	0.12	40.0	1822	0.011	0.014	SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec72 PE=1 SV=1
15	Q9JL10	2.2	35.0	236	0.010	0.093	SRTD1_MOUSE SERTA domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sertad1 PE=1 SV=1
16	Q94FL6	2.9	35.4	436	0.011	0.057	MY124_ARATH Transcription factor MYB124 OS=Arabidopsis thaliana OX=3702 GN=MYB124 PE=1 SV=1
17	P35689	3.5	35.4	1170	0.010	0.018	ERCC5_MOUSE DNA excision repair protein ERCC-5 OS=Mus musculus OX=10090 GN=Ercc5 PE=1 SV=4
18	Q556W2	6.0	34.7	1476	0.014	0.020	ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum OX=44689 GN=abcG17-1 PE=3 SV=1
19	Q8R317	6.8	34.3	582	0.009	0.034	UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus OX=10090 GN=Ubqln1 PE=1 SV=1
20	Q9JJP9	7.0	34.3	582	0.009	0.034	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20252 BIG2_C	3.7e-10	51.7	BIG2 C-terminal domain
2	PF03426 CBM_15	3.1e+02	12.3	Carbohydrate binding domain (family 15)
3	PF16213 DCB	4.1e-10	51.1	Dimerisation and cyclophilin-binding domain of Mon2
4	PF09324 DUF1981	3.2e-08	44.6	Domain of unknown function (DUF1981)
5	PF01369 Sec7	59	14.8	Sec7 domain
6	PF12783 Sec7_N	5	18.5	Guanine nucleotide exchange factor in Golgi transport N-terminal
7	PF16495 SWIRM-assoc_1	73	14.7	SWIRM-associated region 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441875	0.987	Prohibitin-2
2	9606.ENSP00000453962	0.662	Transmembrane protein 253
3	9606.ENSP00000400995	0.545	Biotinidase
4	9606.ENSP00000327487	0.544	tRNA-splicing endonuclease subunit Sen54
5	9606.ENSP00000326031	0.540	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
6	9606.ENSP00000419199	0.534	Ankyrin repeat and SOCS box protein 14
7	9606.ENSP00000383044	0.532	Ubiquitin carboxyl-terminal hydrolase 25
8	9606.ENSP00000256906	0.523	Histamine H4 receptor
9	9606.ENSP00000295746	0.518	Protein CIP2A
10	9606.ENSP00000244227	0.500	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030695	0.996	GTPase regulator activity
GO:0140677	0.986	molecular function activator activity
GO:0005085	0.982	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.967	biological regulation
GO:0009987	0.958	cellular process
GO:0050789	0.886	regulation of biological process
GO:0032502	0.821	developmental process
GO:0032501	0.803	multicellular organismal process
GO:0050794	0.801	regulation of cellular process
GO:0048856	0.792	anatomical structure development
GO:0007275	0.659	multicellular organism development
GO:0051179	0.416	localization
GO:0051234	0.376	establishment of localization
GO:0006810	0.340	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005794	0.974	Golgi apparatus
GO:0005829	0.895	cytosol
GO:0016020	0.860	membrane
GO:0005634	0.833	nucleus
GO:0031974	0.628	membrane-enclosed lumen
GO:0070013	0.607	intracellular organelle lumen
GO:0043228	0.520	non-membrane-bounded organelle
GO:0043232	0.507	intracellular non-membrane-bounded organelle
GO:0031981	0.418	nuclear lumen
GO:0005654	0.376	nucleoplasm
GO:0031090	0.360	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]