StarFunc result for job id Q5TH74

User Input

>input (334 residues)
MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFP
HKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDF
ISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGS
FAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVP
KKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAA
PPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TH74	1.000	1.000	1.418E-49	334	1.000	1.000	Q5TH74.pdb.gz	STPG1_HUMAN O(6)-methylguanine-induced apoptosis 2 OS=Homo sapiens OX=9606 GN=STPG1 PE=1 SV=1
2	AFDB:Q9VPZ7	0.079	0.026	1.162	1342	0.162	0.040	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
3	AFDB:Q389X2	0.056	0.022	2.219	1221	0.171	0.047	Q389X2.pdb.gz	Q389X2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0240 PE=4 SV=1
4	AFDB:P11161	0.096	0.077	2.874	476	0.195	0.137	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
5	AFDB:O35817	0.068	0.051	3.271	502	0.165	0.110	O35817.pdb.gz	AKA14_RAT A-kinase anchor protein 14 OS=Rattus norvegicus OX=10116 GN=Akap14 PE=2 SV=1
6	AFDB:Q99JZ7	0.069	0.053	3.271	461	0.159	0.115	Q99JZ7.pdb.gz	ERRFI_MOUSE ERBB receptor feedback inhibitor 1 OS=Mus musculus OX=10090 GN=Errfi1 PE=1 SV=1
7	AFDB:A0A024RBD8	0.061	0.043	3.971	540	0.162	0.100	A0A024RBD8.pdb.gz
8	AFDB:Q9BRQ0	0.066	0.058	3.971	406	0.174	0.143	Q9BRQ0.pdb.gz	PYGO2_HUMAN Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2
9	AFDB:O15234	0.065	0.038	4.236	703	0.174	0.083	O15234.pdb.gz	CASC3_HUMAN Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2
10	AFDB:Q96QU1	0.067	0.018	4.236	1955	0.174	0.030	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
11	PDB:5ndgn4	0.045	0.120	4.466	118	0.012	0.034	5ndgn4.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
12	PDB:6drdA	0.051	0.018	5.083	1000	0.012	0.004	6drdA.pdb.gz	Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1.
13	PDB:6yxxAf	0.055	0.123	6.171	139	0.024	0.058	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
14	PDB:7rroG	0.067	0.137	6.583	96	0.048	0.167	7rroG.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:3ua4A	0.046	0.024	7.023	640	0.015	0.008	3ua4A.pdb.gz
16	PDB:1dj2A	0.041	0.032	7.492	429	0.009	0.007	1dj2A.pdb.gz	Structures of adenylosuccinate synthetase from Triticum aestivum and Arabidopsis thaliana.
17	PDB:4cbxA	0.042	0.039	7.492	358	0.009	0.008	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
18	PDB:5c0xK	0.054	0.052	7.492	350	0.021	0.020	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:6wq2A	0.048	0.098	7.492	154	0.012	0.026	6wq2A.pdb.gz	Structures of filamentous viruses infecting hyperthermophilic archaea explain DNA stabilization in extreme environments.
20	PDB:5c0wK	0.059	0.041	8.526	576	0.021	0.012	5c0wK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TH74	0.0	682	334	1.000	1.000	STPG1_HUMAN O(6)-methylguanine-induced apoptosis 2 OS=Homo sapiens OX=9606 GN=STPG1 PE=1 SV=1
2	Q57XU0	4.99e-04	44.3	2395	0.219	0.030	Q57XU0_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.130 PE=4 SV=1
3	Q8N801	0.043	37.4	248	0.096	0.129	STPG4_HUMAN Protein STPG4 OS=Homo sapiens OX=9606 GN=STPG4 PE=1 SV=2
4	Q9DAG5	0.083	36.6	247	0.066	0.089	STPG4_MOUSE Protein STPG4 OS=Mus musculus OX=10090 GN=Stpg4 PE=1 SV=1
5	Q38DR1	1.2	33.5	476	0.051	0.036	Q38DR1_TRYB2 Sperm-tail PG-rich repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2450 PE=4 SV=1
6	O13097	1.6	32.7	329	0.060	0.061	EFNB1_XENLA Ephrin-B1 OS=Xenopus laevis OX=8355 GN=efnb1 PE=1 SV=2
7	Q9P2P6	1.8	33.1	4700	0.078	0.006	STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens OX=9606 GN=STARD9 PE=1 SV=3
8	Q9D9W1	5.1	30.8	207	0.063	0.101	CMAP3_MOUSE Ciliary microtubule-associated protein 3 OS=Mus musculus OX=10090 GN=Cimap3 PE=1 SV=1
9	O73612	5.3	31.2	334	0.057	0.057	EFNB1_CHICK Ephrin-B1 OS=Gallus gallus OX=9031 GN=EFNB1 PE=2 SV=1
10	Q90Z33	9.0	30.4	341	0.057	0.056	Q90Z33_DANRE Ephrin-B1 OS=Danio rerio OX=7955 GN=efnb1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07004 SHIPPO-rpt	1.9e-08	46.0	Sperm-tail PG-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349930	0.543	Olfactory receptor 11G2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0048522	0.939	positive regulation of cellular process
GO:0016043	0.921	cellular component organization
GO:0006996	0.910	organelle organization
GO:0007006	0.864	mitochondrial membrane organization
GO:0090559	0.863	regulation of membrane permeability
GO:0006839	0.859	mitochondrial transport
GO:0008219	0.839	cell death
GO:0046902	0.733	regulation of mitochondrial membrane permeability
GO:0012501	0.689	programmed cell death
GO:0010942	0.689	positive regulation of cell death
GO:0006915	0.660	apoptotic process
GO:0043065	0.659	positive regulation of apoptotic process
GO:0008637	0.616	apoptotic mitochondrial changes
GO:0019222	0.560	regulation of metabolic process
GO:0031323	0.486	regulation of cellular metabolic process
GO:0060255	0.354	regulation of macromolecule metabolic process
GO:0051171	0.322	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0005634	0.979	nucleus
GO:0005737	0.899	cytoplasm
GO:0120025	0.696	plasma membrane bounded cell projection
GO:0043232	0.556	intracellular non-membrane-bounded organelle
GO:0005929	0.522	cilium
GO:0016020	0.446	membrane
GO:0099513	0.384	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]