StarFunc result for job id Q5THK1

User Input

>input (2151 residues)
MLSSGVETQPVPLDSSMSAVVQELYSELPVSVSRELHADPEPSVIPDVKPGASSSLLSQN
RALPLELQRTHVESCCEETYETLDHGSEPGRCGLVDSTAGGSVASGILDRAKRSESMEPK
VFRDPGGQAGIIREPSEGAKEDPHQHSTAAEEKTSPSQEDLLMQSSKELSHVDLPEDFLR
SKEGNVQITAETLLKSAEVQGMKVNGTKTDNNEGHKNGNVSKDLSAGCGEFQEVDKIMTS
DEVSETSTLVTPEPLTFVDPVLTEATPKEKECEELKSCPWLSLPGNSAISNVDNGKEELC
KPNLVCEADDNHQQLHGHHNEQPSSTHDSPTATSPLKENSEVSCFTSDLSGPESRTISLE
NCGFEGGGLLKRSAEKTDSSYFYRGDDQGKNLASREENEERLLIPRSERGGPFLFNAREP
EKEISGRCSGEKEPVVSPKENIHNNCIQDSLHTGNSSSLMPNSFTEATEVMLNKNDLKIT
VHVQGNLTNPEDHKETFTNMSHPGGHSEESSFSSLMQIEEAGQTTPVEPNILSKSFYTKD
CNSLVSIQRNLEGNTQLNEASCNDFLFERKSIVSLMPEDQISPVSEVLKPKQGTALLLPS
PEFDYRPESEKVIQTSHDDIPLLDEQSIACEMNELSCTNELVVNKVESECVLNQQVSLNS
QEHANLPTDSLLHLNKEMPLATGRDAHQSHHPPLEGRADVIADIQTIPIQTKIKDISPPG
NQTCGASSNCPTLNIKPVSLERKKEMADSGTKALHSRLRSNKREAAGFPQVVSVIECHSV
QSQDISSCHRVRKNVSQENMCSASAAFKSSKISLQVDNSLITKYENAFQHRDHCCQGTGH
SVEKSSCKVSYTSQERELDGKETNGSLPGDKIRNKMVAGLLNSGISNKTIHTSSSIKLSE
EGLEGKEQDVSKETVFCKYNISDHAIQELNQTVNIPGPEKVLDQSPTVMFSSFKNVKSVE
TLDQKADEVLDCQSNQNRPDECKSEGQSAKEMLSSDQRETVTEPHGEVNHNQKDLLVSSG
SNNSLPCGSPKKCNLKGAFVKMSGCDESTEGMVDIVYTDCSNKLAEGVLDVKASNLLDCG
ARQEKLAFQEDSRSTLSRRELDAAHTGTTGQDSDFPVTAASTVDFLKIKKSCEENVCRSL
KDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGS
RLEPNSEFGKESTFGISSKESMSCHDESSVSLRSLKSIEIMPSQENSETNVNSEETDLKN
LCKPKDGEMLCENVKDCTVLPEMKEIVSRDWSNSSDRDSVCTCVEKNACKACHPHENSSD
RHLPLTVKTDIKVKGEETEEHQRGRLGYLTVGEQSEELVTRETGDGDPVSNISQTHFKCR
GILNHAEKQQSPEVLDYMLQKEEKYIRQQKAHTISQQCISSSLLLDDAQNQNQPKADKDE
STMINEITLAKLAKDSIVAQTQKLEDQKEERLHHPLRKDTESCTSPCLLGAPRKAQDPSS
AGCDQIHGAFAKKGVLPLKKQPHRTCKKVSYQEQIIVGRKIGKIRSSAFLKSSSNPIPTK
AHRLLSLCTLSAPTRLEPETAPTKSLVSHIPKQMSTPCHPLRSLNFRKTTKESALLNKLS
ILASKLAPAMKTQKLRYRRCSSELLPMAKSYKRLRYKRLLDGFSSSTEQLNPYLAASGWD
KRPNSKPMALYSLESIKMTFIDLSNKMPSLLFGSEIFPVSFHVKSSSSDCTTESSRTFPE
HCAPARLALGEALQCPSQPPKWTFSFFLSHGCPGMATFREDTGVHSQTHTQAPPQPPAPL
QDYGGTAIVQTRADCSVLGLHTLLALCSPGCYRIWTKKRSFSSHMPTMQRLFMTQFTQGL
KGLRSPASIADKVFCSLPYSVGRVLSIWSQHGPSVCSFEISSLHSPHCKRQPSLGTTSSH
TMLPYVPLPGMEATYNTSGSQTRLEPPFPALVPKSCLVAESAVSKLLLSASEFQVRGLDE
LDGVKAACPCPQSSPPEQKEAEPEKRPKKVSQIRIRKTIPRPDPNLTPMGLPRPKRLKKK
EFSLEEIYTNKNYKSPPANRCLETIFEEPKERNGTLISISQQKRKRVLEFQDFTVPRKRR
ARGKVKVAGSFTRAQKAAVQSRELDALLIQKLMELETFFAKEEEQEQSSGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0K3AUE4	0.027	0.029	1.967E-4	1968	0.123	0.134	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
2	AFDB:Q9VIQ9	0.033	0.032	3.864E-4	2197	0.111	0.109	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
3	AFDB:Q5SS00	0.032	0.028	4.422E-4	2493	0.161	0.139	Q5SS00.pdb.gz	ZDBF2_MOUSE DBF4-type zinc finger-containing protein 2 homolog OS=Mus musculus OX=10090 GN=Zdbf2 PE=2 SV=1
4	AFDB:O46048	0.024	0.028	4.392E-3	2342	0.149	0.137	O46048.pdb.gz	O46048_DROME EG:133E12.4 protein OS=Drosophila melanogaster OX=7227 GN=east PE=1 SV=1
5	AFDB:Q8IRW8	0.029	0.027	4.392E-3	2431	0.117	0.104	Q8IRW8.pdb.gz	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
6	AFDB:Q9VID9	0.029	0.026	4.699E-3	2663	0.147	0.119	Q9VID9.pdb.gz	Q9VID9_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=BEST:LD19244 PE=1 SV=3
7	AFDB:Q9VWF2	0.030	0.031	6.156E-3	2006	0.125	0.134	Q9VWF2.pdb.gz	SAYP_DROME Supporter of activation of yellow protein OS=Drosophila melanogaster OX=7227 GN=e(y)3 PE=1 SV=3
8	AFDB:E7F568	0.029	0.040	8.628E-3	1343	0.081	0.130	E7F568.pdb.gz	COBL_DANRE Protein cordon-bleu OS=Danio rerio OX=7955 GN=cobl PE=1 SV=2
9	AFDB:F1QF92	0.028	0.029	9.230E-3	2105	0.128	0.131	F1QF92.pdb.gz	F1QF92_DANRE ALMS1 centrosome and basal body-associated protein OS=Danio rerio OX=7955 GN=alms1 PE=4 SV=1
10	AFDB:Q07436	0.029	0.038	1.813E-2	1427	0.067	0.101	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
11	PDB:7nacw	0.016	0.047	8.057	672	0.006	0.019	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:6ke6A8	0.020	0.057	9.222	548	0.005	0.018	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
13	PDB:7edxc	0.025	0.206	9.222	127	0.008	0.142	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BWN1	7.99e-32	135	585	0.033	0.123	PRR14_HUMAN Proline-rich protein 14 OS=Homo sapiens OX=9606 GN=PRR14 PE=1 SV=1
2	Q008X5	0.005	44.7	4555	0.016	0.007	R1A_WBV24 Replicase polyprotein 1a OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=1a PE=1 SV=1
3	Q008X6	0.006	44.7	6872	0.016	0.005	R1AB_WBV24 Replicase polyprotein 1ab OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=rep PE=1 SV=1
4	Q56Y74	0.48	38.1	663	0.012	0.038	MORC6_ARATH Protein MICRORCHIDIA 6 OS=Arabidopsis thaliana OX=3702 GN=MORC6 PE=1 SV=1
5	P17370	1.8	35.4	316	0.018	0.123	PG031_VACCW Protein C4 OS=Vaccinia virus (strain Western Reserve) OX=10254 GN=OPG031 PE=2 SV=2
6	P53932	2.7	35.4	642	0.019	0.064	YNJ5_YEAST Uncharacterized transporter YNL095C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL095C PE=1 SV=1
7	Q8T0D4	6.1	33.9	299	0.013	0.090	TANT_DROME Protein tantalus OS=Drosophila melanogaster OX=7227 GN=tant PE=1 SV=1
8	P98163	8.7	33.9	1984	0.009	0.010	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15386 Tantalus	7.9e-20	81.9	Drosophila Tantalus-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331845

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266712	0.745	Transmembrane and TPR repeat-containing protein 3
2	9606.ENSP00000382241	0.735	Glutamine and serine rich 1
3	9606.ENSP00000368920	0.704	NHL repeat containing 3
4	9606.ENSP00000248975	0.642	14-3-3 protein eta
5	9606.ENSP00000418447	0.631	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
6	9606.ENSP00000324804	0.603	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
7	9606.ENSP00000396234	0.602	DEP domain containing 4
8	9606.ENSP00000265271	0.593	RNA-binding protein 27
9	9606.ENSP00000370303	0.559	Palmitoyltransferase ZDHHC21
10	9606.ENSP00000482907	0.557	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
11	9606.ENSP00000480958	0.537	Zinc finger protein 280B
12	9606.ENSP00000301286	0.521	Perilipin-4
13	9606.ENSP00000399415	0.519	Kynurenine--oxoglutarate transaminase 1
14	9606.ENSP00000225573	0.509	Pyridoxine-5'-phosphate oxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.553	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0065007	0.895	biological regulation
GO:0050789	0.842	regulation of biological process
GO:0032502	0.790	developmental process
GO:0050794	0.787	regulation of cellular process
GO:0071704	0.487	organic substance metabolic process
GO:0032501	0.320	multicellular organismal process
GO:0044237	0.305	cellular metabolic process
GO:0061061	0.302	muscle structure development
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0032991	0.983	protein-containing complex
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005737	0.963	cytoplasm
GO:0005634	0.842	nucleus
GO:0016020	0.820	membrane
GO:0005829	0.513	cytosol
GO:0070013	0.411	intracellular organelle lumen
GO:0071944	0.356	cell periphery
GO:0043232	0.310	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]