StarFunc result for job id Q5THR3

User Input

>input (1501 residues)
MCKMAIIPDWLRSHPHTRKFTHSRPHSSPCRVYSRNGSPNKFRSSSTTAVANPTLSSLDV
KRILFQKITDRGDELQKAFQLLDTGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPL
STSGTVPYLAFLSRFGGIDLYINGIKRGGGNEMNCCRTLRELEIQVGEKVFKNIKTVMKA
FELIDVNKTGLVRPQELRRVLETFCMKLRDEEYEKFSKHYNIHKDTAVDYNVFLKNLSIN
NDLNLRYCMGNQEVSLENQQAKNSKKERLLGSASSEDIWRNYSLDEIERNFCLQLSKSYE
KVEKALSAGDPCKGGYVSFNYLKIVLDTFVYQIPRRIFIQLMKRFGLKATTKINWKQFLT
SFHEPQGLQVSSKGPLTKRNSINSRNESHKENIITKLFRHTEDHSASLKKALLIINTKPD
GPITREEFRYILNCMAVKLSDSEFKELMQMLDPGDTGVVNTSMFIDLIEENCRMRKTSPC
TDAKTPFLLAWDSVEEIVHDTITRNLQAFYNMLRSYDLGDTGRIGRNNFKKIMHVFCPFL
TNAHFIKLCSKIQDIGSGRILYKKLLACIGIDGPPTVSPVLVPKDQLLSEHLQKDEQQQP
DLSERTKLTEDKTTLTKKMTTEEVIEKFKKCIQQQDPAFKKRFLDFSKEPNGKINVHDFK
KVLEDTGMPMDDDQYALLTTKIGFEKEGMSYLDFAAGFEDPPMRGPETTPPQPPTPSKSY
VNSHFITAEECLKLFPRRLKESFRDPYSAFFKTDADRDGIINMHDLHRLLLHLLLNLKDD
EFERFLGLLGLRLSVTLNFREFQNLCEKRPWRTDEAPQRLIRPKQKVADSELACEQAHQY
LVTKAKNRWSDLSKNFLETDNEGNGILRRRDIKNALYGFDIPLTPREFEKLWARYDTEGK
GHITYQEFLQKLGINYSPAVHRPCAEDYFNFMGHFTKPQQLQEEMKELQQSTEKAVAARD
KLMDRHQDISKAFTKTDQSKTNYISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHDNA
INYLDFLRAVENSKSTGAQPKEKEESMPINFATLNPQEAVRKIQEVVESSQLALSTAFSA
LDKEDTGFVKATEFGQVLKDFCYKLTDNQYHYFLRKLRIHLTPYINWKYFLQNFSCFLEE
TADEWAEKMPKGPPPTSPKATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREE
FRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRFSSETAATPMATGDSAVAQR
GSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTTVIPGTPPLQNCDPIESRLRKR
IQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNLDISKEECQQLIIKYDLKSNGKFA
YCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEAGAETPSFYSALLRIQPKIVHCWRPMR
RTFKSYDEAGTGLLSVADFRTVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFL
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5THR3	1.000	1.000	0.000	1501	1.000	1.000	Q5THR3.pdb.gz	EFCB6_HUMAN EF-hand calcium-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=EFCAB6 PE=1 SV=1
2	AFDB:Q385C3	0.074	0.102	1.251E-17	954	0.099	0.155	Q385C3.pdb.gz	Q385C3_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4320 PE=4 SV=1
3	AFDB:P25071	0.060	0.195	4.103E-6	324	0.038	0.176	P25071.pdb.gz	CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana OX=3702 GN=CML12 PE=1 SV=3
4	AFDB:Q57ZJ9	0.059	0.056	1.225E-5	1642	0.123	0.112	Q57ZJ9.pdb.gz	Q57ZJ9_TRYB2 SAM domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.750 PE=4 SV=1
5	AFDB:Q57VP1	0.053	0.056	1.768E-4	1430	0.055	0.058	Q57VP1.pdb.gz	Q57VP1_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.230 PE=3 SV=1
6	AFDB:Q382E7	0.043	0.287	9.322E-4	186	0.024	0.194	Q382E7.pdb.gz	Q382E7_TRYB2 Centrin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5470 PE=4 SV=1
7	AFDB:Q8TD86	0.049	0.328	9.322E-4	181	0.017	0.138	Q8TD86.pdb.gz	CALL6_HUMAN Calmodulin-like protein 6 OS=Homo sapiens OX=9606 GN=CALML6 PE=1 SV=2
8	AFDB:Q8IJC7	0.050	0.314	1.212E-3	179	0.028	0.235	Q8IJC7.pdb.gz	Q8IJC7_PLAF7 Centrin-3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1027700.1 PE=4 SV=2
9	PDB:5d43A	0.045	0.374	1.835E-3	150	0.017	0.173	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
10	AFDB:P41209	0.050	0.340	1.877E-3	172	0.021	0.186	P41209.pdb.gz	CETN1_MOUSE Centrin-1 OS=Mus musculus OX=10090 GN=Cetn1 PE=1 SV=1
11	PDB:2n6aA	0.057	0.281	2.186E-3	162	0.026	0.241	2n6aA.pdb.gz	An investigation of calcium mediate signaling by the Connexin 36 gap junction protein
12	PDB:5a2hA	0.040	0.326	2.186E-3	147	0.023	0.231	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
13	AFDB:A0A060WZV7	0.063	0.258	2.236E-3	197	0.024	0.183	A0A060WZV7.pdb.gz	A0A060WZV7_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006413001 PE=4 SV=1
14	PDB:6hr1A	0.064	0.168	2.284E-3	406	0.023	0.084	6hr1A.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
15	PDB:3wfnB	0.044	0.347	2.493E-3	169	0.023	0.207	3wfnB.pdb.gz
16	PDB:2be4A	0.059	0.230	2.721E-3	270	0.029	0.163	2be4A.pdb.gz
17	PDB:6xu4A	0.059	0.160	2.969E-3	389	0.021	0.082	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.
18	PDB:6xyrA	0.059	0.167	2.969E-3	348	0.026	0.112	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
19	PDB:1osaA	0.041	0.306	3.241E-3	148	0.023	0.236	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
20	PDB:6ya9A	0.060	0.152	3.696E-3	400	0.023	0.087	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5THR3	0.0	3134	1501	1.000	1.000	EFCB6_HUMAN EF-hand calcium-binding domain-containing protein 6 OS=Homo sapiens OX=9606 GN=EFCAB6 PE=1 SV=1
2	P69097	4.30e-06	50.4	149	0.022	0.221	CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=2
3	O23320	7.01e-06	49.7	151	0.027	0.265	CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=CML8 PE=1 SV=1
4	P07463	7.86e-06	49.7	149	0.023	0.235	CALM_PARTE Calmodulin OS=Paramecium tetraurelia OX=5888 GN=CAM PE=1 SV=3
5	F4IVN6	1.41e-05	49.7	181	0.023	0.193	F4IVN6_ARATH Calmodulin 5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
6	P0DH97	2.38e-05	48.1	149	0.025	0.248	CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana OX=3702 GN=CAM2 PE=1 SV=1
7	P0DH98	2.38e-05	48.1	149	0.025	0.248	CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana OX=3702 GN=CAM3 PE=1 SV=1
8	Q682T9	2.38e-05	48.1	149	0.025	0.248	CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana OX=3702 GN=CAM5 PE=1 SV=1
9	P24044	3.21e-05	47.8	149	0.023	0.235	CALM_PLAFA Calmodulin OS=Plasmodium falciparum OX=5833 GN=CAM PE=1 SV=4
10	P62203	3.21e-05	47.8	149	0.023	0.235	CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CAM PE=1 SV=2
11	P60204	3.24e-05	47.8	149	0.021	0.208	CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=camA PE=1 SV=2
12	B4DJ51	3.85e-05	47.8	149	0.023	0.228	B4DJ51_HUMAN Calmodulin 1 (Phosphorylase kinase, delta), isoform CRA_a OS=Homo sapiens OX=9606 GN=HEL-S-72 PE=1 SV=1
13	G1NK53	3.85e-05	47.4	148	0.023	0.230	G1NK53_MELGA Calmodulin 1 OS=Meleagris gallopavo OX=9103 GN=CALM1 PE=4 SV=1
14	P0DP23	3.85e-05	47.8	149	0.023	0.228	CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1
15	P0DP24	3.85e-05	47.8	149	0.023	0.228	CALM2_HUMAN Calmodulin-2 OS=Homo sapiens OX=9606 GN=CALM2 PE=1 SV=1
16	P0DP25	3.85e-05	47.8	149	0.023	0.228	CALM3_HUMAN Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1
17	P0DP26	3.85e-05	47.8	149	0.023	0.228	CALM1_MOUSE Calmodulin-1 OS=Mus musculus OX=10090 GN=Calm1 PE=1 SV=1
18	P0DP27	3.85e-05	47.8	149	0.023	0.228	CALM2_MOUSE Calmodulin-2 OS=Mus musculus OX=10090 GN=Calm2 PE=1 SV=1
19	P0DP28	3.85e-05	47.8	149	0.023	0.228	CALM3_MOUSE Calmodulin-3 OS=Mus musculus OX=10090 GN=Calm3 PE=1 SV=1
20	P0DP29	3.85e-05	47.8	149	0.023	0.228	CALM1_RAT Calmodulin-1 OS=Rattus norvegicus OX=10116 GN=Calm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	4.1e+02	12.3	Caleosin related protein
2	PF00404 Dockerin_1	11	17.6	Dockerin type I domain
3	PF00036 EF-hand_1	7.7e-22	86.2	EF hand
4	PF08976 EF-hand_11	2.9e-85	293.3	EF-hand domain
5	PF13202 EF-hand_5	0.023	25.3	EF hand
6	PF13405 EF-hand_6	2e-29	109.9	EF-hand domain
7	PF13499 EF-hand_7	5.5e-48	172.6	EF-hand domain pair
8	PF13833 EF-hand_8	3.2e-15	66.9	EF-hand domain pair
9	PF14658 EF-hand_9	0.13	24.0	EF-hand domain
10	PF16905 GPHH	1	20.6	Voltage-dependent L-type calcium channel, IQ-associated
11	PF06640 P_C	4.8e+02	12.0	P protein C-terminus
12	PF01099 Uteroglobin	5.7e+02	12.4	Uteroglobin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262726

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418770	0.881	Protein/nucleic acid deglycase DJ-1
2	9606.ENSP00000465676	0.643	E3 SUMO-protein ligase PIAS2
3	9606.ENSP00000353590	0.621	Myosin-10
4	9606.ENSP00000363822	0.614	Androgen receptor
5	9606.ENSP00000450832	0.614	Signal-induced proliferation-associated 1-like protein 1
6	9606.ENSP00000357583	0.611	Type I inositol 1,4,5-trisphosphate 5-phosphatase
7	9606.ENSP00000362444	0.608	Disks large-associated protein 3
8	9606.ENSP00000370057	0.599	FERM and PDZ domain-containing protein 4
9	9606.ENSP00000316674	0.586	Actin-like protein 9
10	9606.ENSP00000334415	0.560	Protein FAM183A
11	9606.ENSP00000326699	0.542	Calmegin
12	9606.ENSP00000355731	0.541	Serine/threonine-protein kinase MRCK alpha
13	9606.ENSP00000328524	0.536	DENN domain-containing protein 5A
14	9606.ENSP00000326238	0.528	F-actin-capping protein subunit alpha-3
15	9606.ENSP00000266505	0.525	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
16	9606.ENSP00000299575	0.522	ATM interactor
17	9606.ENSP00000374049	0.516	Von Willebrand factor A domain containing 3A
18	9606.ENSP00000258042	0.515	Neuromedin-B receptor
19	9606.ENSP00000286349	0.515	Tripartite motif-containing protein 42
20	9606.ENSP00000319222	0.515	Putative protein ZNF720

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.501	ion binding
GO:0046872	0.483	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.966	cellular process
GO:0032501	0.762	multicellular organismal process
GO:0032502	0.691	developmental process
GO:0048856	0.589	anatomical structure development
GO:0065007	0.572	biological regulation
GO:0008152	0.440	metabolic process
GO:0071704	0.428	organic substance metabolic process
GO:0050896	0.392	response to stimulus
GO:0044238	0.386	primary metabolic process
GO:0050789	0.356	regulation of biological process
GO:0050794	0.332	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.923	cytoplasm
GO:0043228	0.717	non-membrane-bounded organelle
GO:0043232	0.706	intracellular non-membrane-bounded organelle
GO:0005856	0.327	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]