StarFunc result for job id Q5TIA1

User Input

>input (1274 residues)
MAVRQAATAGTPGPRREEEAALLFERAHYRHDPRWLLPVTPRLCLACALELLPDPGVSLV
RKKHMLSCFQDALVRHTSLVTQLVSQDQRVCIHFISVLFGLLCSMEDGSVTDLCIEVLIQ
ITTQLKLEQTIRCLLDECHKELCNMPSMRGSLATLTLLGKLVDAIPALADELVMEHGNLM
EHLLRGLVYPSEGIQASVCYLYGKLYSSPVAAEMLSGHFREKLFPLFLSILDGAQTKELQ
INCLGLLRQLLKYDLFVSMIMNQDGLGESAKNIEGSSGNTSLPLVLKKLLLSRDETLQVA
SAHCITAVLVHSPAKHASAFIHADIPEFLFEHLSSSSEVLVWSSCNCLTLLVEEPLFFSK
CHTVYGIEAVVRSLQGSLKMNNIELHKQGLLLFAEILTRQPEEIKLFTSSAMCRDAGRAL
QEAVSSPVLEVAAEALKATSAFLRKDHQSTPPVQYGELQALLEAMLNRCAEFSQTLLSRR
PLGHASSRDSEKAILQRGKFLLSTLEGFRSACRLAIEFQSEPSAQENPFTAPSAKKEDTL
EAFSEFLLSACDSLCIPMVMRHLEQTTHPALMEVFLSILHNLFVIVPHMKEKFSKKLASS
SFIRLTLELKARFCSGLSHSALNQVCSNFLYYMCLNLLSAPEKTGPPSKEELSAVSELLQ
HGLPQISSRSPESLAFLSDRQYMEGAARQRQYCILLLFYLAYIHEDRFVSEAELFEAVQS
FLLSLQDQGERPPLVVFKASIYLLAICQDKDNTLRETMVSAIRKFLEGIPDLQLVYTHHP
LLLRFFLLYPELMSRYGHRVLELWFFWEESSYEELDDVTSAGQPALPASLVVLFQLLRSI
PSILLILLDLIYSSPVDTAHKVLISLRTFLRRNEDIQVGGLIRGHFLLILQRLLVEHGAS
PSGASGNLPLLLSLLSLMQLRNVSEQELDSVAMKLLHQVSKLCGKCSPTDVDILQPSFNF
LYWSLHQTTPSSQKRAAAVLLSSTGLMELLEKMLALTLAKADSPRTALLCSAWLLTASFS
AQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVP
SGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSP
DIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLFMRYRSSSVLSHEEVGDVLQGV
ALADLSTLSNTTLQALHGFFQQLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDML
CLGGVAVSLSHIRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D4I2	0.803	0.806	0.000	1268	0.800	0.804	Q9D4I2.pdb.gz	MEII1_MOUSE Meiosis inhibitor protein 1 OS=Mus musculus OX=10090 GN=Mei1 PE=2 SV=4
2	AFDB:O23277	0.513	0.496	1.284E-18	1330	0.158	0.151	O23277.pdb.gz	PRD1_ARATH Protein PUTATIVE RECOMBINATION INITIATION DEFECT 1 OS=Arabidopsis thaliana OX=3702 GN=PRD1 PE=1 SV=3
3	AFDB:Q8L5Y6	0.245	0.254	5.028E-11	1219	0.135	0.141	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
4	AFDB:O75155	0.225	0.231	7.175E-10	1236	0.141	0.145	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
5	AFDB:B3CJ34	0.155	0.100	1.080E-9	2634	0.134	0.065	B3CJ34.pdb.gz	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
6	AFDB:Q8I3M5	0.217	0.241	1.281E-9	1123	0.119	0.135	Q8I3M5.pdb.gz	Q8I3M5_PLAF7 Karyopherin beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0524000 PE=4 SV=1
7	AFDB:P97536	0.242	0.248	2.711E-9	1230	0.127	0.132	P97536.pdb.gz	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
8	AFDB:Q9VKY2	0.229	0.233	2.711E-9	1248	0.121	0.123	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
9	AFDB:Q10197	0.161	0.180	3.326E-9	1105	0.108	0.124	Q10197.pdb.gz	ALP1_SCHPO Tubulin-folding cofactor D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp1 PE=1 SV=3
10	PDB:4a0cA	0.246	0.267	3.534E-9	1155	0.119	0.132	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
11	AFDB:Q9VEZ3	0.123	0.085	5.179E-9	2042	0.134	0.084	Q9VEZ3.pdb.gz	MSPS_DROME Protein mini spindles OS=Drosophila melanogaster OX=7227 GN=msps PE=1 SV=3
12	PDB:6xu2A	0.191	0.214	1.451E-7	1091	0.096	0.112	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	PDB:7unkA	0.210	0.247	2.503E-7	1047	0.124	0.151	7unkA.pdb.gz
14	PDB:6x9oA	0.192	0.115	2.589E-7	2425	0.140	0.073	6x9oA.pdb.gz
15	PDB:7mp6B	0.148	0.130	4.173E-7	1609	0.159	0.126	7mp6B.pdb.gz
16	PDB:3nd2A	0.194	0.268	7.706E-7	861	0.086	0.127	3nd2A.pdb.gz
17	PDB:1qgkA	0.222	0.303	8.831E-7	876	0.093	0.135	1qgkA.pdb.gz
18	PDB:7mqaSP	0.161	0.102	9.454E-7	2485	0.143	0.073	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:3w3uA	0.217	0.259	1.121E-6	1030	0.101	0.125	3w3uA.pdb.gz
20	PDB:7sx3E	0.225	0.191	1.375E-6	1611	0.148	0.117	7sx3E.pdb.gz	Structural architecture of the human NALCN channelosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D4I2	0.0	2014	1268	0.800	0.804	MEII1_MOUSE Meiosis inhibitor protein 1 OS=Mus musculus OX=10090 GN=Mei1 PE=2 SV=4
2	O23277	0.38	37.7	1330	0.064	0.061	PRD1_ARATH Protein PUTATIVE RECOMBINATION INITIATION DEFECT 1 OS=Arabidopsis thaliana OX=3702 GN=PRD1 PE=1 SV=3
3	Q13075	4.2	34.3	1403	0.013	0.012	BIRC1_HUMAN Baculoviral IAP repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NAIP PE=1 SV=3
4	Q8T9L5	6.0	33.5	567	0.027	0.060	Q8T9L5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lkb1 PE=2 SV=1
5	O35526	8.6	32.7	288	0.026	0.115	STX1A_MOUSE Syntaxin-1A OS=Mus musculus OX=10090 GN=Stx1a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384115

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232603	0.765	MORC family CW-type zinc finger protein 1
2	9606.ENSP00000358742	0.756	Swi5-dependent recombination DNA repair protein 1 homolog
3	9606.ENSP00000360310	0.733	Meiotic recombination protein SPO11
4	9606.ENSP00000333836	0.650	Fidgetin
5	9606.ENSP00000361562	0.642	Lysosomal protective protein
6	9606.ENSP00000253023	0.641	NEDD8-conjugating enzyme Ubc12
7	9606.ENSP00000351990	0.641	NEDD8-activating enzyme E1 regulatory subunit
8	9606.ENSP00000356381	0.632	Katanin p60 ATPase-containing subunit A1
9	9606.ENSP00000369989	0.623	Katanin p60 ATPase-containing subunit A-like 1
10	9606.ENSP00000250495	0.608	NEDD8
11	9606.ENSP00000386541	0.608	26S proteasome non-ATPase regulatory subunit 14
12	9606.ENSP00000328423	0.606	Meiotic recombination protein REC114
13	9606.ENSP00000293695	0.594	Synaptonemal complex central element protein 2
14	9606.ENSP00000299140	0.569	Spermatogenesis-associated protein 19, mitochondrial
15	9606.ENSP00000350162	0.567	Synaptonemal complex protein 2
16	9606.ENSP00000355167	0.566	HORMA domain-containing protein 1
17	9606.ENSP00000358535	0.561	Synaptonemal complex protein 1
18	9606.ENSP00000379226	0.561	Testis-expressed protein 11
19	9606.ENSP00000292782	0.548	DCN1-like protein 1
20	9606.ENSP00000350036	0.548	Structural maintenance of chromosomes protein 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0022402	0.976	cell cycle process
GO:0022414	0.969	reproductive process
GO:0000280	0.965	nuclear division
GO:0048232	0.963	male gamete generation
GO:0140013	0.960	meiotic nuclear division
GO:0061982	0.932	meiosis I cell cycle process
GO:0032502	0.900	developmental process
GO:0007127	0.893	meiosis I
GO:0051234	0.888	establishment of localization
GO:0000226	0.860	microtubule cytoskeleton organization
GO:0051640	0.854	organelle localization
GO:0022412	0.842	cellular process involved in reproduction in multicellular organism
GO:0007059	0.802	chromosome segregation
GO:0045132	0.733	meiotic chromosome segregation
GO:0003006	0.728	developmental process involved in reproduction
GO:0051301	0.715	cell division
GO:0050000	0.706	chromosome localization
GO:0007283	0.674	spermatogenesis
GO:0071704	0.572	organic substance metabolic process
GO:0051276	0.494	chromosome organization
GO:0048856	0.432	anatomical structure development
GO:0051641	0.431	cellular localization
GO:0050789	0.408	regulation of biological process
GO:0051649	0.386	establishment of localization in cell
GO:0043170	0.348	macromolecule metabolic process
GO:0044238	0.337	primary metabolic process
GO:0070192	0.332	chromosome organization involved in meiotic cell cycle
GO:0045143	0.332	homologous chromosome segregation
GO:0006807	0.324	nitrogen compound metabolic process
GO:0030154	0.314	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0005654	0.814	nucleoplasm
GO:0071944	0.701	cell periphery
GO:0005815	0.503	microtubule organizing center
GO:0005829	0.473	cytosol
GO:0016020	0.456	membrane
GO:0005886	0.397	plasma membrane
GO:0012505	0.395	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]