StarFunc result for job id Q5TIE3

User Input

>input (1220 residues)
MPGLLNWITGAALPLTASDVTSCVSGYALGLTASLTYGNLEAQPFQGLFVYPLDECTTVI
GFEAVIADRVVTVQIKDKAKLESGHFDASHVRSPTVTGNILQDGVSIAPHSCTPGKVTLD
EDLERILFVANLGTIAPMENVTIFISTSSELPTLPSGAVRVLLPAVCAPTVPQFCTKSTG
TSNQQAQGKDRHCFGAWAPGSWNKLCLATLLNTEVSNPMEYEFNFQLEIRGPCLLAGVES
PTHEIRADAAPSARSAKSIIITLANKHTFDRPVEILIHPSEPHMPHVLIEKGDMTLGEFD
QHLKGRTDFIKGMKKKSRAERKTEIIRKRLHKDIPHHSVIMLNFCPDLQSVQPCLRKAHG
EFIFLIDRSSSMSGISMHRVKDAMLVALKSLMPACLFNIIGFGSTFKSLFPSSQTYSEDS
LAMACDDIQRMKADMGGTNILSPLKWVIRQPVHRGHPRLLFVITDGAVNNTGKVLELVRN
HAFSTRCYSFGIGPNVCHRLVKGLASVSEGSAELLMEGERLQPKMVKSLKKAMAPVLSDV
TVEWIFPETTEVLVSPVSASSLFPGERLVGYGIVCDASLHISNPRSDKRRRYSMLHSQES
GSSVFYHSQDDGPGLEGGDCAKNSGAPFILGQAKNARLASGDSTTKHDLNLSQRRRAYST
NQITNHKPLPRATMASDPMPAAKRYPLRKARLQDLTNQTSLDVQRWQIDLQPLLNSGQDL
NQGPKLRGPGARRPSLLPQGCQPFLPWGQETQAWSPVRERTSDSRSPGDLEPSHHPSAFE
TETSSDWDPPAESQERASPSRPATPAPVLGKALVKGLHDSQRLQWEVSFELGTPGPERGG
AQDADLWSETFHHLAARAIIRDFEQLAEREGEIEQGSNRRYQVSALHTSKACNIISKYTA
FVPVDVSKSRYLPTVVEYPNSAALRMLGSRALAQQWRGTSSGFGRPQTMLGEDSAPGNGK
FQALNMEASPTALFSEARSPGREKHGASEGPQRSLATNTLSSMKASENLFGSWLNLNKSR
LLTRAAKGFLSKPLIKAVESTSGNQSFDYIPLVSLQLASGAFLLNEAFCEATHIPMEKLK
WTSPFTCHRVSLTTRPSESKTPSPQLCTSSPPRHPSCDSFSLEPLAKGKLGLEPRAVVEH
TGKLWATVVGLAWLEHSSASYFTEWELVAAKANSWLEQQEVPEGRTQGTLKAAARQLFVL
LRHWDENLEFNMLCYNPNYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PYK3	0.271	0.181	2.702E-33	1969	0.199	0.123	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
2	AFDB:Q6UXX5	0.246	0.231	1.762E-23	1313	0.147	0.136	Q6UXX5.pdb.gz	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
3	PDB:6jp8F	0.127	0.156	2.198E-8	973	0.034	0.042	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
4	AFDB:Q8NFW1	0.129	0.100	5.397E-7	1626	0.101	0.076	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
5	AFDB:E9Q7P1	0.121	0.093	5.959E-7	1613	0.091	0.069	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
6	PDB:1m2vA	0.135	0.215	5.123E-6	705	0.025	0.043	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
7	AFDB:A0A0R4IR54	0.126	0.097	1.352E-5	1622	0.098	0.073	A0A0R4IR54.pdb.gz
8	PDB:4nenA	0.114	0.130	1.450E-5	1063	0.030	0.034	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
9	PDB:4nehA	0.113	0.126	1.858E-5	1084	0.029	0.032	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
10	PDB:7zs96	0.126	0.351	2.502E-5	383	0.024	0.076	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
11	PDB:5es4B	0.125	0.208	3.050E-5	674	0.034	0.061	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
12	PDB:6zgaA	0.126	0.190	6.105E-5	751	0.026	0.043	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
13	PDB:6zgaB	0.132	0.190	7.083E-5	786	0.031	0.048	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
14	PDB:6ujaB	0.126	0.362	1.284E-4	359	0.034	0.117	6ujaB.pdb.gz	Cryo-EM Reveals Integrin-Mediated TGF-beta Activation without Release from Latent TGF-beta.
15	PDB:7nupD	0.110	0.146	1.349E-4	884	0.016	0.023	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
16	AFDB:Q2UY11	0.127	0.135	1.170E-3	1141	0.083	0.089	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
17	AFDB:P36170	0.037	0.038	8.492E-3	1169	0.056	0.058	P36170.pdb.gz	FLO10_YEAST Flocculation protein FLO10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO10 PE=3 SV=1
18	AFDB:Q9LNC4	0.041	0.054	4.358E-2	766	0.066	0.104	Q9LNC4.pdb.gz	GTE4_ARATH Transcription factor GTE4 OS=Arabidopsis thaliana OX=3702 GN=GTE4 PE=2 SV=1
19	AFDB:Q1T6W7	0.053	0.053	5.867E-2	1219	0.067	0.067	Q1T6W7.pdb.gz	Q1T6W7_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=2
20	AFDB:Q8N3D4	0.042	0.035	1.012E-1	1523	0.080	0.064	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00534	2.07e-63	233	786	0.140	0.218	VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=2
2	Q8C1D4	5.99e-61	226	804	0.139	0.211	Q8C1D4_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=AW551984 PE=2 SV=1
3	Q8BGF0	6.39e-61	226	804	0.139	0.211	Q8BGF0_MOUSE Expressed sequence AW551984 OS=Mus musculus OX=10090 GN=AW551984 PE=1 SV=1
4	Q99KC8	7.67e-59	220	793	0.133	0.204	VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=Vwa5a PE=1 SV=2
5	B4DHS6	4.33e-45	171	431	0.116	0.327	B4DHS6_HUMAN cDNA FLJ55206, highly similar to Loss of heterozygosity 11 chromosomal region 2 gene A protein OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=1
6	Q6P8K4	6.05e-42	168	763	0.070	0.113	Q6P8K4_MOUSE AW551984 protein OS=Mus musculus OX=10090 GN=AW551984 PE=2 SV=1
7	Q54LJ4	1.58e-30	134	2563	0.113	0.054	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
8	E9PYK3	7.48e-24	112	1969	0.101	0.062	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
9	Q9UKK3	3.39e-23	109	1724	0.102	0.072	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
10	Q8L798	2.49e-17	90.1	754	0.052	0.084	Q8L798_ARATH Inter-alpha-trypsin inhibitor heavy chain-like protein OS=Arabidopsis thaliana OX=3702 GN=At1g19110 PE=1 SV=1
11	D3Z518	1.49e-11	67.4	210	0.039	0.224	D3Z518_MOUSE Expressed sequence AW551984 (Fragment) OS=Mus musculus OX=10090 GN=AW551984 PE=1 SV=1
12	Q86UX2	3.29e-11	70.5	942	0.051	0.066	ITIH5_HUMAN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Homo sapiens OX=9606 GN=ITIH5 PE=2 SV=2
13	P19827	4.68e-10	66.6	911	0.047	0.063	ITIH1_HUMAN Inter-alpha-trypsin inhibitor heavy chain H1 OS=Homo sapiens OX=9606 GN=ITIH1 PE=1 SV=3
14	Q8BJD1	1.20e-09	65.5	952	0.050	0.064	ITIH5_MOUSE Inter-alpha-trypsin inhibitor heavy chain H5 OS=Mus musculus OX=10090 GN=Itih5 PE=1 SV=1
15	Q61702	1.07e-07	58.9	907	0.048	0.065	ITIH1_MOUSE Inter-alpha-trypsin inhibitor heavy chain H1 OS=Mus musculus OX=10090 GN=Itih1 PE=1 SV=2
16	Q14624	4.35e-07	57.0	930	0.055	0.072	ITIH4_HUMAN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Homo sapiens OX=9606 GN=ITIH4 PE=1 SV=4
17	A6X935	2.94e-06	54.3	942	0.048	0.063	ITIH4_MOUSE Inter alpha-trypsin inhibitor, heavy chain 4 OS=Mus musculus OX=10090 GN=Itih4 PE=1 SV=2
18	Q5EBC0	4.45e-06	53.5	933	0.048	0.063	Q5EBC0_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=4 SV=1
19	O35802	4.49e-06	53.5	932	0.048	0.063	O35802_RAT Inter-alpha-inhibitor H4 heavy chain OS=Rattus norvegicus OX=10116 GN=Itih4 PE=2 SV=1
20	D3ZFC6	5.17e-06	53.5	927	0.048	0.064	D3ZFC6_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08487 VIT	0.099	24.2	Vault protein inter-alpha-trypsin domain
2	PF13757 VIT_2	1.9e-31	119.1	Vault protein inter-alpha-trypsin domain
3	PF00092 VWA	5.1e-06	38.4	von Willebrand factor type A domain
4	PF13519 VWA_2	2.7e-05	36.1	von Willebrand factor type A domain
5	PF13768 VWA_3	8e-26	102.3	von Willebrand factor type A domain
6	PF05762 VWA_CoxE	12	16.7	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364220

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000437957	0.840	Uncharacterized protein KIAA2012
2	9606.ENSP00000269586	0.689	Putative ADP-ribosylation factor-like protein 5C
3	9606.ENSP00000354791	0.689	Dynactin subunit 1
4	9606.ENSP00000386607	0.641	V-set and transmembrane domain-containing protein 5
5	9606.ENSP00000483879	0.636	XK-related protein 5
6	9606.ENSP00000287652	0.603	Putative deoxyribonuclease TATDN2
7	9606.ENSP00000349298	0.575	E3 ubiquitin-protein ligase MYLIP
8	9606.ENSP00000343244	0.529	Dual specificity protein phosphatase 21
9	9606.ENSP00000283206	0.506	Transmembrane protein 87B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0032501	0.991	multicellular organismal process
GO:0009987	0.988	cellular process
GO:0048856	0.975	anatomical structure development
GO:0007275	0.626	multicellular organism development
GO:0048731	0.516	system development
GO:0065007	0.502	biological regulation
GO:0048513	0.424	animal organ development
GO:0050789	0.354	regulation of biological process
GO:0030154	0.325	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.913	cytoplasm
GO:0005829	0.424	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]