StarFunc result for job id Q5TYM5

User Input

>input (149 residues)
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNGHFWMFHSQAVYDINRLDSTGV
NVLLWGNLPEIEESTDEDVLNISAEECIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0Y354	0.895	0.895	1.162E-25	149	0.980	0.980	H0Y354.pdb.gz	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
2	AFDB:A1KXW8	0.866	0.866	1.495E-24	149	0.893	0.893	A1KXW8.pdb.gz	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
3	AFDB:A0A087WSW5	0.421	0.645	4.173E-10	94	0.510	0.809	A0A087WSW5.pdb.gz	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
4	AFDB:Q9P802	0.511	0.405	1.555E-4	194	0.128	0.098	Q9P802.pdb.gz	MIS18_SCHPO Kinetochore protein mis18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis18 PE=1 SV=2
5	AFDB:Q9CZJ6	0.486	0.368	5.419E-4	204	0.161	0.118	Q9CZJ6.pdb.gz	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
6	PDB:6h0gB	0.458	0.195	6.903E-4	401	0.107	0.040	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
7	AFDB:A0A024R9N0	0.453	0.313	1.012E-3	229	0.148	0.096	A0A024R9N0.pdb.gz
8	AFDB:A2AQ14	0.483	0.315	1.012E-3	241	0.141	0.087	A2AQ14.pdb.gz	MS18B_MOUSE Protein Mis18-beta OS=Mus musculus OX=10090 GN=Oip5 PE=2 SV=1
9	AFDB:Q9VH36	0.455	0.131	1.593E-3	585	0.114	0.029	Q9VH36.pdb.gz	CRBN_DROME Protein cereblon OS=Drosophila melanogaster OX=7227 GN=ohgt PE=1 SV=1
10	AFDB:Q2V3E2	0.464	0.625	2.116E-3	105	0.128	0.181	Q2V3E2.pdb.gz	YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana OX=3702 GN=At4g27740 PE=3 SV=1
11	AFDB:Q9NYP9	0.484	0.323	2.116E-3	233	0.134	0.086	Q9NYP9.pdb.gz	MS18A_HUMAN Protein Mis18-alpha OS=Homo sapiens OX=9606 GN=MIS18A PE=1 SV=1
12	PDB:5fqdE	0.436	0.197	4.011E-3	367	0.107	0.044	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
13	PDB:2kv1A	0.341	0.395	1.321E-2	124	0.114	0.137	2kv1A.pdb.gz
14	PDB:6h61A	0.400	0.109	5.779E-2	660	0.114	0.026	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
15	PDB:6symA	0.359	0.385	1.354E-1	135	0.101	0.111	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
16	PDB:8dvsA	0.421	0.107	2.528E-1	682	0.087	0.019	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
17	PDB:6j6qF	0.137	0.128	3.981E-1	161	0.060	0.056	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:5yzgY	0.143	0.109	8.327E-1	204	0.054	0.039	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:1x0tA	0.170	0.223	1.555	106	0.060	0.085	1x0tA.pdb.gz	Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
20	PDB:7abzC	0.125	0.095	2.065	209	0.013	0.010	7abzC.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TYM5	2.68e-108	306	149	1.000	1.000	FA72A_HUMAN Protein FAM72A OS=Homo sapiens OX=9606 GN=FAM72A PE=1 SV=1
2	Q86X60	4.55e-107	303	149	0.987	0.987	FA72B_HUMAN Protein FAM72B OS=Homo sapiens OX=9606 GN=FAM72B PE=1 SV=2
3	Q6L9T8	8.71e-106	300	149	0.987	0.987	FA72D_HUMAN Protein FAM72D OS=Homo sapiens OX=9606 GN=FAM72D PE=1 SV=1
4	H0Y354	2.19e-104	296	149	0.980	0.980	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
5	A1KXW8	2.04e-95	273	149	0.893	0.893	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
6	A0A087WSW5	1.05e-48	153	94	0.510	0.809	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
7	A0A087WZP4	1.29e-48	153	94	0.510	0.809	A0A087WZP4_HUMAN Family with sequence similarity 72 member B OS=Homo sapiens OX=9606 GN=FAM72B PE=3 SV=1
8	Q8IAM0	1.7	31.2	1397	0.107	0.011	Q8IAM0_PLAF7 Glutamate dehydrogenase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802000 PE=3 SV=1
9	P20054	6.1	29.3	2225	0.208	0.014	PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum OX=44689 GN=pyr1-3 PE=1 SV=3
10	Q1ECF1	7.2	28.9	211	0.101	0.071	PYL7_ARATH Abscisic acid receptor PYL7 OS=Arabidopsis thaliana OX=3702 GN=PYL7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14976 FAM72	8.2e-75	261.3	FAM72 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000559

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000024114	0.647	NDC80 kinetochore complex component
2	61853.ENSNLEP00000015095	0.642	TTK protein kinase
3	61853.ENSNLEP00000014148	0.530	Cell division cycle associated 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.987	positive regulation of cellular process
GO:0050790	0.976	regulation of catalytic activity
GO:0009966	0.971	regulation of signal transduction
GO:0048523	0.970	negative regulation of cellular process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0044092	0.924	negative regulation of molecular function
GO:0051338	0.917	regulation of transferase activity
GO:0051246	0.892	regulation of protein metabolic process
GO:0010605	0.866	negative regulation of macromolecule metabolic process
GO:0031399	0.841	regulation of protein modification process
GO:0001932	0.820	regulation of protein phosphorylation
GO:0045859	0.813	regulation of protein kinase activity
GO:0010941	0.776	regulation of cell death
GO:0010469	0.753	regulation of signaling receptor activity
GO:0050732	0.753	negative regulation of peptidyl-tyrosine phosphorylation
GO:0061097	0.750	regulation of protein tyrosine kinase activity
GO:0006469	0.750	negative regulation of protein kinase activity
GO:0043067	0.726	regulation of programmed cell death
GO:0009987	0.718	cellular process
GO:0042981	0.716	regulation of apoptotic process
GO:0010942	0.675	positive regulation of cell death
GO:0023057	0.650	negative regulation of signaling
GO:0043065	0.650	positive regulation of apoptotic process
GO:0009968	0.628	negative regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.549	nucleus
GO:0070013	0.535	intracellular organelle lumen
GO:0031981	0.532	nuclear lumen
GO:0043232	0.505	intracellular non-membrane-bounded organelle
GO:0016020	0.364	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]