StarFunc result for job id Q5TZA2

User Input

>input (2017 residues)
MSLGLARAQEVELTLETVIQTLESSVLCQEKGLGARDLAQDAQITSLPALIREIVTRNLS
QPESPVLLPATEMASLLSLQEENQLLQQELSRVEDLLAQSRAERDELAIKYNAVSERLEQ
ALRLEPGELETQEPRGLVRQSVELRRQLQEEQASYRRKLQAYQEGQQRQAQLVQRLQGKI
LQYKKRCSELEQQLLERSGELEQQRLRDTEHSQDLESALIRLEEEQQRSASLAQVNAMLR
EQLDQAGSANQALSEDIRKVTNDWTRCRKELEHREAAWRREEESFNAYFSNEHSRLLLLW
RQVVGFRRLVSEVKMFTERDLLQLGGELARTSRAVQEAGLGLSTGLRLAESRAEAALEKQ
ALLQAQLEEQLRDKVLREKDLAQQQMQSDLDKADLSARVTELGLAVKRLEKQNLEKDQVN
KDLTEKLEALESLRLQEQAALETEDGEGLQQTLRDLAQAVLSDSESGVQLSGSERTADAS
NGSLRGLSGQRTPSPPRRSSPGRGRSPRRGPSPACSDSSTLALIHSALHKRQLQVQDMRG
RYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDGAMQAHEDAQREVQRLRSANEL
LSREKSNLAHSLQVAQQQAEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRE
LERSHRQLEQLEGKRSVLAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVEL
ELSMTKLRAEEASLQDSLSKLSALNESLAQDKLDLNRLVAQLEEEKSALQGRQRQAEQEA
TVAREEQERLEELRLEQEVARQGLEGSLRVAEQAQEALEQQLPTLRHERSQLQEQLAQLS
RQLSGREQELEQARREAQRQVEALERAAREKEALAKEHAGLAVQLVAAEREGRTLSEEAT
RLRLEKEALEGSLFEVQRQLAQLEARREQLEAEGQALLLAKETLTGELAGLRQQIIATQE
KASLDKELMAQKLVQAEREAQASLREQRAAHEEDLQRLQREKEAAWRELEAERAQLQSQL
QREQEELLARLEAEKEELSEEIAALQQERDEGLLLAESEKQQALSLKESEKTALSEKLMG
TRHSLATISLEMERQKRDAQSRQEQDRSTVNALTSELRDLRAQREEAAAAHAQEVRRLQE
QARDLGKQRDSCLREAEELRTQLRLLEDARDGLRRELLEAQRKLRESQEGREVQRQEAGE
LRRSLGEGAKEREALRRSNEELRSAVKKAESERISLKLANEDKEQKLALLEEARTAVGKE
AGELRTGLQEVERSRLEARRELQELRRQMKMLDSENTRLGRELAELQGRLALGERAEKES
RRETLGLRQRLLKGEASLEVMRQELQVAQRKLQEQEGEFRTRERRLLGSLEEARGTEKQQ
LDHARGLELKLEAARAEAAELGLRLSAAEGRAQGLEAELARVEVQRRAAEAQLGGLRSAL
RRGLGLGRAPSPAPRPVPGSPARDAPAEGSGEGLNSPSTLECSPGSQPPSPGPATSPASP
DLDPEAVRGALREFLQELRSAQRERDELRTQTSALNRQLAEMEAERDSATSRARQLQKAV
AESEEARRSVDGRLSGVQAELALQEESVRRSERERRATLDQVATLERSLQATESELRASQ
EKISKMKANETKLEGDKRRLKEVLDASESRTVKLELQRRSLEGELQRSRLGLSDREAQAQ
ALQDRVDSLQRQVADSEVKAGTLQLTVERLNGALAKVEESEGALRDKVRGLTEALAQSSA
SLNSTRDKNLHLQKALTACEHDRQVLQERLDAARQALSEARKQSSSLGEQVQTLRGEVAD
LELQRVEAEGQLQQLREVLRQRQEGEAAALNTVQKLQDERRLLQERLGSLQRALAQLEAE
KREVERSALRLEKDRVALRRTLDKVEREKLRSHEDTVRLSAEKGRLDRTLTGAELELAEA
QRQIQQLEAQVVVLEQSHSPAQLEVDAQQQQLELQQEVERLRSAQAQTERTLEARERAHR
QRVRGLEEQVSTLKGQLQQELRRSSAPFSPPSGPPEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TZA2	1.000	1.000	0.000	2017	1.000	1.000	Q5TZA2.pdb.gz	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
2	AFDB:Q8CJ40	0.121	0.122	0.000	2009	0.824	0.827	Q8CJ40.pdb.gz	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
3	AFDB:E7F2T0	0.098	0.099	1.160E-52	1959	0.369	0.380	E7F2T0.pdb.gz	E7F2T0_DANRE Ciliary rootlet coiled-coil, rootletin family member 2 OS=Danio rerio OX=7955 GN=crocc2 PE=4 SV=1
4	AFDB:Q9VCD1	0.075	0.074	8.399E-27	2048	0.261	0.257	Q9VCD1.pdb.gz	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
5	AFDB:Q60952	0.080	0.071	1.335E-22	2414	0.271	0.226	Q60952.pdb.gz	CP250_MOUSE Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4
6	AFDB:Q9BV73	0.071	0.061	2.185E-20	2442	0.271	0.224	Q9BV73.pdb.gz	CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2
7	AFDB:Q09EF7	0.098	0.101	8.215E-8	1955	0.194	0.200	Q09EF7.pdb.gz	CROCC_CAEEL Rootletin OS=Caenorhabditis elegans OX=6239 GN=che-10 PE=2 SV=2
8	AFDB:Q9VKI0	0.051	0.048	9.902E-3	2189	0.149	0.137	Q9VKI0.pdb.gz	Q9VKI0_DROME CENP-meta, isoform C OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=3
9	AFDB:E9Q512	0.056	0.057	1.128E-2	1976	0.188	0.192	E9Q512.pdb.gz	E9Q512_MOUSE Thyroid hormone receptor interactor 11 OS=Mus musculus OX=10090 GN=Trip11 PE=1 SV=1
10	AFDB:Q96Q89	0.059	0.064	1.670E-2	1820	0.093	0.103	Q96Q89.pdb.gz	KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B PE=1 SV=3
11	PDB:4v60A	0.030	0.063	4.032	812	0.024	0.060	4v60A.pdb.gz
12	PDB:7o4i1	0.022	0.067	7.261	522	0.018	0.069	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WW81	0.0	1340	838	0.363	0.874	A0A087WW81_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=6
2	B1AKD8	0.0	2296	1311	0.617	0.950	B1AKD8_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
3	E7F2T0	0.0	991	1959	0.390	0.401	E7F2T0_DANRE Ciliary rootlet coiled-coil, rootletin family member 2 OS=Danio rerio OX=7955 GN=crocc2 PE=4 SV=1
4	Q5TZA2	0.0	3756	2017	1.000	1.000	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
5	Q8CJ40	0.0	2996	2009	0.826	0.829	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
6	Q9BV73	1.56e-123	437	2442	0.237	0.196	CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2
7	Q60952	1.08e-105	380	2414	0.201	0.168	CP250_MOUSE Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4
8	Q86T23	1.11e-50	176	111	0.049	0.892	CROL1_HUMAN Putative ciliary rootlet coiled-coil protein-like 1 protein OS=Homo sapiens OX=9606 GN=CROCCP2 PE=5 SV=1
9	H2L0I4	5.75e-22	107	2392	0.172	0.145	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
10	H2L0I3	1.85e-21	105	2323	0.064	0.056	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
11	H2L0I2	3.23e-21	104	2396	0.064	0.054	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
12	Q9VCD1	1.18e-09	66.6	2048	0.016	0.016	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
13	Q382P4	7.11e-08	60.5	1299	0.061	0.095	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
14	P10567	1.55e-04	49.3	872	0.056	0.128	MYSP_CAEEL Paramyosin OS=Caenorhabditis elegans OX=6239 GN=unc-15 PE=1 SV=2
15	A2AL36	0.004	45.1	2334	0.024	0.021	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
16	Q09EF7	0.004	45.1	1955	0.015	0.016	CROCC_CAEEL Rootletin OS=Caenorhabditis elegans OX=6239 GN=che-10 PE=2 SV=2
17	Q8MSN3	0.004	44.7	1230	0.012	0.020	Q8MSN3_DROME AT16851p OS=Drosophila melanogaster OX=7227 GN=Root PE=2 SV=1
18	A0A087WYC0	0.005	44.3	796	0.040	0.102	A0A087WYC0_HUMAN Golgin A2 (Fragment) OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=2
19	Q7Z7A1	0.014	43.1	2325	0.018	0.016	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
20	P90901	0.028	42.0	575	0.053	0.184	IFA1_CAEEL Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10473 CENP-F_leu_zip	6.1	18.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
2	PF19220 Crescentin	3.3	18.3	Crescentin protein
3	PF15035 Rootletin	1.2e-58	209.9	Ciliary rootlet component, centrosome cohesion

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306760	0.914	Leucine-rich repeat-containing protein 45
2	9606.ENSP00000298532	0.828	snRNA-activating protein complex subunit 4
3	9606.ENSP00000355966	0.817	Serine/threonine-protein kinase Nek2
4	9606.ENSP00000356224	0.782	Nesprin-1
5	9606.ENSP00000370021	0.754	Centlein
6	9606.ENSP00000257287	0.730	Centrosomal protein of 135 kDa
7	9606.ENSP00000352572	0.720	Pericentrin
8	9606.ENSP00000343818	0.718	CDK5 regulatory subunit-associated protein 2
9	9606.ENSP00000356042	0.686	Ezrin
10	9606.ENSP00000287482	0.677	Spindle assembly abnormal protein 6 homolog
11	9606.ENSP00000358495	0.677	Immunoglobulin superfamily member 3
12	9606.ENSP00000265849	0.668	Mismatch repair endonuclease PMS2
13	9606.ENSP00000318374	0.661	Leukocyte receptor cluster member 8
14	9606.ENSP00000370208	0.661	RAB guanine nucleotide exchange factor 1
15	9606.ENSP00000370337	0.658	Centrosomal protein of 152 kDa
16	9606.ENSP00000370803	0.644	Centriolar coiled-coil protein of 110 kDa
17	9606.ENSP00000260731	0.614	Kinesin-like protein KIF11
18	9606.ENSP00000371472	0.611	Ninein
19	9606.ENSP00000372857	0.611	Serine/threonine-protein kinase Nek11
20	9606.ENSP00000268057	0.602	Bardet-Biedl syndrome 4 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0031023	0.976	microtubule organizing center organization
GO:0051641	0.969	cellular localization
GO:0044087	0.953	regulation of cellular component biogenesis
GO:0033043	0.953	regulation of organelle organization
GO:0048522	0.946	positive regulation of cellular process
GO:0007098	0.939	centrosome cycle
GO:0008104	0.921	protein localization
GO:1902115	0.801	regulation of organelle assembly
GO:0010638	0.795	positive regulation of organelle organization
GO:0044089	0.765	positive regulation of cellular component biogenesis
GO:0032879	0.608	regulation of localization
GO:1902117	0.588	positive regulation of organelle assembly
GO:0033365	0.487	protein localization to organelle
GO:1903829	0.427	positive regulation of protein localization
GO:0022607	0.365	cellular component assembly
GO:1902017	0.330	regulation of cilium assembly
GO:0070925	0.327	organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005813	0.999	centrosome
GO:0043227	0.995	membrane-bounded organelle
GO:0005886	0.991	plasma membrane
GO:0005814	0.986	centriole
GO:0005576	0.845	extracellular region
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0031982	0.691	vesicle
GO:0070062	0.678	extracellular exosome
GO:0032991	0.423	protein-containing complex
GO:0070013	0.372	intracellular organelle lumen
GO:0015629	0.307	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]