StarFunc result for job id Q5TZJ5

User Input

>input (1347 residues)
MENLPFPLKLLSASSLNAPSSTPWVLDIFLTLVFALGFFFLLLPYLSYFRCDDPPSPSPG
KRKCPVGRRRRPRGRMKNHSLRAGRECPRGLQETSDLLSQLQSLLGPHLDKGDFGQLSGP
DPPGEVGERAPDGASQSSHEPMEDAAPILSPLASPDPQAKHPQDLASTPSPGPMTTSVSS
LSASQPPEPSLPLEHPSPEPPALFPHPPHTPDPLACSPPPPKGFTAPPLRDSTLITPSHC
DSVALPLGTVPQSLSPHEDLVASVPAISGLGGSNSHVSASSRWQETARTSCAFNSSVQQD
HLSRHPPETYQMEAGSLFLLSSDGQNAVGIQVTETAKVNIWEEKENVGSFTDRMTPEKHL
NSLRNLAKSLDAEQDTTNPKPFWNMGENSKQLPGPQKLSDPRLWQESFWKNYSQLFWGLP
SLHSESLVANAWVTDRSYTLQSPPFLFNEMSNVCPIQRETTMSPLLFQAQPPSHLGPECQ
PFISSTPQFRPTPMAQAEAQAHLQSSFPVLSPAFPSLIKNTGVACPASQNKVQALSLPET
QHPEWPLLRRQLEGRLALPSRVQKSQDVFSVSTPNLPQESLTSILPENFPVSPELRRQLE
QHIKKWIIQHWGNLGRIQESLDLMQLRDESPGTSQAKGKPSPWQSSMSTGESSKEAQKVK
FQLERDPCPHLGQILGETPQNLSRDMKSFPRKVLGVTSEESERNLRKPLRSDSGSDLLRC
TERTHIENILKAHMGRNLGQTNEGLIPVRVRRSWLAVNQALPVSNTHVKTSNLAAPKSGK
ACVNTAQVLSFLEPCTQQGLGAHIVRFWAKHRWGLPLRVLKPIQCFKLEKVSSLSLTQLA
GPSSATCESGAGSEVEVDMFLRKPPMASLRKQVLTKASDHMPESLLASSPAWKQFQRAPR
GIPSWNDHGPLKPPPAGQEGRWPSKPLTYSLTGSTQQSRSLGAQSSKAGETREAVPQCRV
PLETCMLANLQATSEDMHGFEAPGTSKSSLHPRVSVSQDPRKLCLMEEVVNEFEPGMATK
SETQPQVCAAVVLLPDGQASVVPHASENLVSQVPQGHLQSMPAGNMRASQELHDLMAARR
SKLVHEEPRNPNCQGSCKNQRPMFPPIHKSEKSRKPNLEKHEERLEGLRTPQLTPVRKTE
DTHQDEGVQLLPSKKQPPSVSHFGGNIKQFFQWIFSKKKSKPAPVTAESQKTVKNRSCVY
SSSAEAQGLMTAVGQMLDEKMSLCHARHASKVNQHKQKFQAPVCGFPCNHRHLFYSEHGR
ILSYAASSQQATLKSQGCPNRDRQIRNQQPLKSVRCNNEQWGLRHPQILHPKKAVSPVSP
LQHWPKTSGASSHHHHCPRHCLLWEGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWB4	0.216	0.216	0.000	1347	0.984	0.984	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	AFDB:A0A0B4KHZ9	0.033	0.037	8.144E-4	1151	0.120	0.141	A0A0B4KHZ9.pdb.gz	A0A0B4KHZ9_DROME Biorientation defective 1, isoform E OS=Drosophila melanogaster OX=7227 GN=BOD1 PE=1 SV=1
3	AFDB:Q8I398	0.041	0.030	3.211E-3	2112	0.113	0.072	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
4	AFDB:A1ZA47	0.043	0.029	3.945E-3	2194	0.151	0.093	A1ZA47.pdb.gz	ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster OX=7227 GN=Zasp52 PE=1 SV=2
5	AFDB:Q63624	0.059	0.062	4.846E-3	1258	0.135	0.145	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
6	AFDB:P70365	0.033	0.034	6.376E-3	1447	0.129	0.120	P70365.pdb.gz	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
7	AFDB:Q9DB00	0.041	0.027	6.376E-3	2260	0.140	0.083	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
8	AFDB:M9PGK7	0.038	0.026	1.031E-2	2272	0.141	0.084	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
9	AFDB:Q6A065	0.042	0.037	1.104E-2	1588	0.154	0.130	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
10	AFDB:P51521	0.044	0.044	2.884E-2	1351	0.122	0.121	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
11	PDB:7qskm	0.029	0.162	6.717	128	0.019	0.195	7qskm.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
12	PDB:7nac7	0.024	0.150	7.705	129	0.014	0.147	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
13	PDB:7ajtCL	0.030	0.051	8.838	781	0.013	0.023	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:6hivAU	0.023	0.120	9.465	175	0.016	0.120	6hivAU.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7ajuCL	0.030	0.049	9.465	808	0.009	0.015	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7d63RJ	0.030	0.050	9.465	796	0.013	0.023	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	0.0	2688	1347	0.984	0.984	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	8.78e-149	480	1048	0.265	0.341	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1
3	Q6ZU69	0.021	42.0	1335	0.018	0.018	S31F1_HUMAN Protein SPATA31F1 OS=Homo sapiens OX=9606 GN=SPATA31F1 PE=2 SV=4
4	Q6NLX7	0.063	38.5	179	0.018	0.134	Q6NLX7_ARATH At4g36660 OS=Arabidopsis thaliana OX=3702 GN=AP22.12 PE=1 SV=1
5	P25940	2.7	35.0	1745	0.024	0.018	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
6	G3V608	3.3	34.7	896	0.030	0.045	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
7	A0A8I5ZUN3	3.6	34.7	35375	0.024	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
8	A0A8I6GE59	3.8	34.3	787	0.030	0.051	A0A8I6GE59_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
9	Q78ZF5	7.2	33.5	896	0.029	0.044	Q78ZF5_RAT Interleukin-3 receptor beta-subunit OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=2 SV=1
10	A0A024R7N1	8.1	33.5	970	0.019	0.027	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
11	Q9P107	8.1	33.5	970	0.019	0.027	GMIP_HUMAN GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2
12	A6NFR6	8.7	32.7	353	0.041	0.156	CE060_HUMAN Uncharacterized protein C5orf60 OS=Homo sapiens OX=9606 GN=C5orf60 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	6.5e-18	76.1	Domain of unknown function (DUF4599)
2	PF14650 FAM75	1.1e-127	438.4	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366875

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000469337	0.656	Leucine-rich repeat-containing protein 63
2	9606.ENSP00000308873	0.654	Coiled-coil domain containing 74B
3	9606.ENSP00000367913	0.627	Putative protein FAM47C
4	9606.ENSP00000396747	0.621	Ankyrin repeat domain-containing protein 60
5	9606.ENSP00000367353	0.616	Uncharacterized protein C12orf42
6	9606.ENSP00000392252	0.566	Protein monoglycylase TTLL8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.846	cellular process
GO:0065007	0.822	biological regulation
GO:0008152	0.643	metabolic process
GO:0050789	0.599	regulation of biological process
GO:0050794	0.545	regulation of cellular process
GO:0071704	0.464	organic substance metabolic process
GO:0044238	0.362	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0031410	0.992	cytoplasmic vesicle
GO:0030141	0.946	secretory granule
GO:0001669	0.859	acrosomal vesicle
GO:0005829	0.337	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]