StarFunc result for job id Q5U5Q3

User Input

>input (659 residues)
MPSGSSAALALAAAPAPLPQPPPPPPPPPPPLPPPSGGPELEGDGLLLRERLAALGLDDP
SPAEPGAPALRAPAAAAQGQARRAAELSPEERAPPGRPGAPEAAELELEEDEEEGEEAEL
DGDLLEEEELEEAEEEDRSSLLLLSPPAATASQTQQIPGGSLGSVLLPAARFDAREAAAA
AAAAGVLYGGDDAQGMMAAMLSHAYGPGGCGAAAAALNGEQAALLRRKSVNTTECVPVPS
SEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHF
SMIRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYI
VTPSRDKEPVFEVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGT
LGSAWLSSNPVPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWF
GDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPS
TPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPP
ESRRKHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U5Q3	1.000	1.000	1.652E-95	659	1.000	1.000	Q5U5Q3.pdb.gz	MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Homo sapiens OX=9606 GN=MEX3C PE=1 SV=3
2	PDB:6ke6RC	0.106	0.222	5.526E-5	278	0.041	0.097	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
3	PDB:7mqaSW	0.119	0.327	7.903E-5	195	0.049	0.164	7mqaSW.pdb.gz	Nucleolar maturation of the human small subunit processome.
4	PDB:7ajuJJ	0.111	0.304	1.435E-4	199	0.030	0.101	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
5	PDB:7mq8NY	0.105	0.204	2.178E-4	274	0.044	0.106	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	AFDB:A0A0G2K916	0.107	0.032	1.098E-3	2615	0.135	0.034	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
7	PDB:6zqbJO	0.097	0.242	4.562E-3	236	0.036	0.102	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
8	PDB:2f1fA	0.076	0.249	1.504E-2	163	0.026	0.104	2f1fA.pdb.gz
9	PDB:5wq8A	0.070	0.091	1.596E-2	496	0.032	0.042	5wq8A.pdb.gz
10	PDB:7ogkA	0.089	0.085	2.898E-2	695	0.023	0.022	7ogkA.pdb.gz	A cooperative PNPase-Hfq-RNA carrier complex facilitates bacterial riboregulation.
11	PDB:1mowA	0.076	0.146	5.585E-2	248	0.032	0.085	1mowA.pdb.gz	Design, Activity and Structure of a Highly Specific Artificial Endonuclease
12	PDB:3cw2C	0.089	0.186	9.553E-2	266	0.024	0.060	3cw2C.pdb.gz	Crystal structure of the intact archaeal translation initiation factor 2 demonstrates very high conformational flexibility in the alpha- and beta-subunits.
13	AFDB:A8JNQ4	0.075	0.064	1.021E-1	796	0.144	0.119	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
14	AFDB:Q96QB1	0.063	0.038	3.172E-1	1528	0.127	0.055	Q96QB1.pdb.gz	RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4
15	AFDB:Q9N4P3	0.071	0.081	4.815E-1	558	0.118	0.140	Q9N4P3.pdb.gz	Q9N4P3_CAEEL R3H domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_ZK121.2 PE=1 SV=1
16	AFDB:Q15398	0.083	0.071	8.237E-1	846	0.147	0.115	Q15398.pdb.gz	DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2
17	AFDB:M9PCQ3	0.046	0.033	1.046	1111	0.135	0.080	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
18	AFDB:O94842	0.055	0.058	1.110	621	0.150	0.159	O94842.pdb.gz	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1
19	AFDB:A0A0B4KEI8	0.080	0.052	2.139	1270	0.149	0.077	A0A0B4KEI8.pdb.gz	A0A0B4KEI8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=p190 PE=4 SV=1
20	AFDB:Q8IQN4	0.040	0.028	2.410	1144	0.129	0.074	Q8IQN4.pdb.gz	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05A36	0.0	972	652	0.898	0.908	MEX3C_MOUSE RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Mus musculus OX=10090 GN=Mex3c PE=2 SV=2
2	Q5U5Q3	0.0	1330	659	1.000	1.000	MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Homo sapiens OX=9606 GN=MEX3C PE=1 SV=3
3	Q6ZN04	5.93e-150	448	569	0.455	0.527	MEX3B_HUMAN RNA-binding protein MEX3B OS=Homo sapiens OX=9606 GN=MEX3B PE=1 SV=1
4	Q69Z36	1.66e-142	430	601	0.448	0.491	MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus OX=10090 GN=Mex3b PE=2 SV=2
5	Q86XN8	1.72e-142	431	651	0.392	0.396	MEX3D_HUMAN RNA-binding protein MEX3D OS=Homo sapiens OX=9606 GN=MEX3D PE=1 SV=3
6	A1L020	7.63e-100	317	520	0.252	0.319	MEX3A_HUMAN RNA-binding protein MEX3A OS=Homo sapiens OX=9606 GN=MEX3A PE=1 SV=1
7	Q9V4F3	3.85e-83	276	628	0.206	0.217	Q9V4F3_DROME LD09246p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11360 PE=2 SV=2
8	Q95R07	4.86e-75	248	415	0.194	0.308	Q95R07_CAEEL K Homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mex-3 PE=1 SV=1
9	H2L067	1.01e-74	248	443	0.194	0.289	H2L067_CAEEL K Homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mex-3 PE=1 SV=1
10	Q8IGK4	1.04e-07	57.4	580	0.073	0.083	Q8IGK4_DROME RE72930p OS=Drosophila melanogaster OX=7227 GN=Imp PE=2 SV=1
11	E1JJM0	1.06e-07	57.4	580	0.073	0.083	E1JJM0_DROME FI20063p1 OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
12	Q8IR99	1.51e-07	57.0	573	0.067	0.077	Q8IR99_DROME IGF-II mRNA-binding protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
13	M9NF14	1.52e-07	57.0	638	0.073	0.075	M9NF14_DROME IGF-II mRNA-binding protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=1
14	Q0KHU2	2.60e-07	56.2	631	0.073	0.076	Q0KHU2_DROME IGF-II mRNA-binding protein, isoform K OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
15	Q9VZ69	2.81e-07	56.2	566	0.067	0.078	Q9VZ69_DROME IGF-II mRNA-binding protein OS=Drosophila melanogaster OX=7227 GN=Imp PE=1 SV=2
16	A0A8I6ATS5	1.09e-06	54.3	554	0.080	0.096	A0A8I6ATS5_RAT Far upstream element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Fubp3 PE=1 SV=1
17	G3V829	1.20e-06	53.9	569	0.080	0.093	G3V829_RAT Far upstream element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Fubp3 PE=4 SV=1
18	A0A8I6ACQ5	1.75e-06	53.5	556	0.080	0.095	A0A8I6ACQ5_RAT Far upstream element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Fubp3 PE=1 SV=1
19	Q8CJC5	7.42e-06	50.4	254	0.033	0.087	NEUL3_MOUSE E3 ubiquitin-protein ligase NEURL3 OS=Mus musculus OX=10090 GN=Neurl3 PE=2 SV=1
20	A0A8I6G4A0	7.86e-06	51.6	567	0.076	0.088	A0A8I6G4A0_RAT Far upstream element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Fubp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00013 KH_1	1.1e-22	90.9	KH domain
2	PF07650 KH_2	6.5	18.0	KH domain
3	PF13083 KH_4	16	16.8	KH domain
4	PF14447 Prok-RING_4	0.19	23.0	Prokaryotic RING finger family 4
5	PF00097 zf-C3HC4	0.15	23.3	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	1.3e-07	42.7	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385610

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351159	0.774	CCR4-NOT transcription complex subunit 3
2	9606.ENSP00000369213	0.759	Probable ATP-dependent RNA helicase DDX58
3	9606.ENSP00000430493	0.746	CCR4-NOT transcription complex subunit 8
4	9606.ENSP00000377024	0.710	CCR4-NOT transcription complex subunit 6
5	9606.ENSP00000313007	0.705	Polyadenylate-binding protein 1
6	9606.ENSP00000424896	0.691	CCR4-NOT transcription complex subunit 6-like
7	9606.ENSP00000482835	0.679	AP-2 complex subunit beta
8	9606.ENSP00000348216	0.667	E3 ubiquitin-protein ligase TRIM4
9	9606.ENSP00000269466	0.661	Zinc phosphodiesterase ELAC protein 1
10	9606.ENSP00000476046	0.657	mRNA-decapping enzyme 1A
11	9606.ENSP00000445508	0.652	CCR4-NOT transcription complex subunit 4
12	9606.ENSP00000328340	0.651	E3 ubiquitin-protein ligase RNF135
13	9606.ENSP00000320949	0.630	CCR4-NOT transcription complex subunit 1
14	9606.ENSP00000362300	0.619	Protein argonaute-1
15	9606.ENSP00000355279	0.613	CCR4-NOT transcription complex subunit 7
16	9606.ENSP00000318066	0.612	Bis(5'-adenosyl)-triphosphatase ENPP4
17	9606.ENSP00000444596	0.609	E3 ubiquitin-protein ligase MYCBP2
18	9606.ENSP00000387292	0.598	Transmembrane protein 150A
19	9606.ENSP00000462349	0.598	StAR-related lipid transfer protein 6
20	9606.ENSP00000421592	0.597	THO complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0032501	0.915	multicellular organismal process
GO:0048856	0.848	anatomical structure development
GO:0019222	0.609	regulation of metabolic process
GO:0060255	0.566	regulation of macromolecule metabolic process
GO:0007275	0.566	multicellular organism development
GO:0048518	0.562	positive regulation of biological process
GO:0010468	0.479	regulation of gene expression
GO:0048731	0.459	system development
GO:0048519	0.429	negative regulation of biological process
GO:0071704	0.416	organic substance metabolic process
GO:0080090	0.410	regulation of primary metabolic process
GO:0051171	0.410	regulation of nitrogen compound metabolic process
GO:0031323	0.405	regulation of cellular metabolic process
GO:0050896	0.404	response to stimulus
GO:0048522	0.376	positive regulation of cellular process
GO:0044238	0.371	primary metabolic process
GO:0044237	0.323	cellular metabolic process
GO:0050793	0.322	regulation of developmental process
GO:0006807	0.318	nitrogen compound metabolic process
GO:0043170	0.301	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.997	cytosol
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0031981	0.735	nuclear lumen
GO:0005654	0.674	nucleoplasm
GO:0099080	0.513	supramolecular complex
GO:0036464	0.457	cytoplasmic ribonucleoprotein granule
GO:0000932	0.301	P-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]