StarFunc result for job id Q5U651

User Input

>input (963 residues)
MLSGERKEGGSPRFGKLHLPVGLWINSPRKQLAKLGRRWPSAASVKSSSSDTGSRSSEPL
PPPPPHVELRRVGAVKAAGGASGSRAKRISQLFRGSGTGTTGSSGAGGPGTPGGAQRWAS
EKKLPELAAGVAPEPPLATRATAPPGVLKIFGAGLASGANYKSVLATARSTARELVAEAL
ERYGLAGSPGGGPGESSCVDAFALCDALGRPAAAGVGSGEWRAEHLRVLGDSERPLLVQE
LWRARPGWARRFELRGREEARRLEQEAFGAADSEGTGAPSWRPQKNRSRAASGGAALASP
GPGTGSGAPAGSGGKERSENLSLRRSVSELSLQGRRRRQQERRQQALSMAPGAADAQIGT
ADPGDFDQLTQCLIQAPSNRPYFLLLQGYQDAQDFVVYVMTREQHVFGRGGNSSGRGGSP
APYVDTFLNAPDILPRHCTVRAGPEHPAMVRPSRGAPVTHNGCLLLREAELHPGDLLGLG
EHFLFMYKDPRTGGSGPARPPWLPARPGATPPGPGWAFSCRLCGRGLQERGEALAAYLDG
REPVLRFRPREEEALLGEIVRAAAAGSGDLPPLGPATLLALCVQHSARELELGHLPRLLG
RLARLIKEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPLMLWMANTTELLSFV
QEKVLEMEKEADQEDPQLCNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLD
SNPFTAGAELPGPGAELGAMPPGLRPTLGVFQAALELTSQCELHPDLVSQTFGYLFFFSN
ASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGLGDIATEFFRKLSMAVNLLC
VPRTSLLKASWSSLRTDHPTLTPAQLHHLLSHYQLGPGRGPPAAWDPPPAEREAVDTGDI
FESFSSHPPLILPLGSSRLRLTGPVTDDALHRELRRLRRLLWDLEQQELPANYRHGPPVA
TSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U651	1.000	1.000	0.000	963	1.000	1.000	Q5U651.pdb.gz	RAIN_HUMAN Ras-interacting protein 1 OS=Homo sapiens OX=9606 GN=RASIP1 PE=1 SV=1
2	AFDB:Q69Z89	0.404	0.362	5.847E-45	1099	0.310	0.272	Q69Z89.pdb.gz	RADIL_MOUSE Ras-associating and dilute domain-containing protein OS=Mus musculus OX=10090 GN=Radil PE=1 SV=2
3	AFDB:A7UA95	0.403	0.349	6.668E-45	1124	0.297	0.254	A7UA95.pdb.gz	RADIL_DANRE Ras-associating and dilute domain-containing protein OS=Danio rerio OX=7955 GN=radil PE=2 SV=1
4	PDB:7wrgA	0.110	0.129	1.497E-4	812	0.058	0.069	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
5	AFDB:A0A0B4K621	0.089	0.094	2.079E-4	860	0.119	0.134	A0A0B4K621.pdb.gz	A0A0B4K621_DROME Rfx, isoform G OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
6	PDB:7wrgB	0.110	0.133	4.883E-4	783	0.030	0.037	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
7	AFDB:Q9Y2F5	0.075	0.045	1.006E-3	2266	0.118	0.050	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
8	PDB:2kb3A	0.090	0.553	1.459E-3	143	0.025	0.168	2kb3A.pdb.gz
9	AFDB:Q585G4	0.071	0.070	3.743E-3	988	0.159	0.155	Q585G4.pdb.gz	Q585G4_TRYB2 Pumilio/PUF RNA binding protein 4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.50 PE=4 SV=1
10	AFDB:Q15058	0.119	0.075	4.269E-3	1648	0.162	0.095	Q15058.pdb.gz	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
11	AFDB:Q8IN05	0.101	0.080	4.269E-3	1415	0.135	0.092	Q8IN05.pdb.gz	Q8IN05_DROME Liquid facets-Related, isoform D OS=Drosophila melanogaster OX=7227 GN=lqfR PE=1 SV=2
12	AFDB:Q14669	0.080	0.051	4.460E-3	1992	0.126	0.061	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
13	AFDB:Q8IN89	0.078	0.078	4.660E-3	984	0.141	0.138	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
14	PDB:2ff4A	0.093	0.229	8.572E-2	379	0.024	0.061	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:5glhA	0.071	0.117	1.115E-1	452	0.049	0.104	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
16	PDB:3gjxA	0.084	0.080	1.583E-1	1041	0.049	0.045	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
17	PDB:7z8fe	0.068	0.023	1.886E-1	4579	0.053	0.011	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
18	PDB:5tzrA	0.056	0.104	1.970E-1	437	0.049	0.108	5tzrA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.
19	PDB:7wooD	0.070	0.057	2.796E-1	1398	0.040	0.028	7wooD.pdb.gz
20	PDB:3gb8A	0.087	0.087	3.481E-1	958	0.049	0.049	3gb8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F6P4	0.0	671	989	0.442	0.431	E7F6P4_DANRE Ras-interacting protein 1 OS=Danio rerio OX=7955 GN=rasip1 PE=1 SV=3
2	J9PJE8	0.0	671	989	0.442	0.431	J9PJE8_DANRE Ras-interacting protein 1 OS=Danio rerio OX=7955 GN=rasip1 PE=1 SV=1
3	Q3U0S6	0.0	1548	961	0.937	0.939	RAIN_MOUSE Ras-interacting protein 1 OS=Mus musculus OX=10090 GN=Rasip1 PE=1 SV=3
4	Q5U651	0.0	1917	963	1.000	1.000	RAIN_HUMAN Ras-interacting protein 1 OS=Homo sapiens OX=9606 GN=RASIP1 PE=1 SV=1
5	Q96JH8	1.75e-141	451	1075	0.330	0.296	RADIL_HUMAN Ras-associating and dilute domain-containing protein OS=Homo sapiens OX=9606 GN=RADIL PE=1 SV=5
6	Q69Z89	3.29e-141	451	1099	0.327	0.287	RADIL_MOUSE Ras-associating and dilute domain-containing protein OS=Mus musculus OX=10090 GN=Radil PE=1 SV=2
7	A7UA95	6.97e-140	448	1124	0.306	0.262	RADIL_DANRE Ras-associating and dilute domain-containing protein OS=Danio rerio OX=7955 GN=radil PE=2 SV=1
8	Q9QZQ1	7.34e-08	59.3	1820	0.059	0.031	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
9	O35889	9.80e-08	58.9	1829	0.059	0.031	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
10	J3KN01	1.17e-07	58.5	1816	0.058	0.031	J3KN01_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
11	P55196	1.33e-07	58.5	1824	0.058	0.031	AFAD_HUMAN Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3
12	A8MQ02	1.50e-07	58.2	1781	0.058	0.031	A8MQ02_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
13	Q5TIG5	2.02e-07	57.8	1665	0.058	0.034	Q5TIG5_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
14	Q9NQX4	9.16e-07	55.5	1742	0.081	0.045	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2
15	A0A0B4KGI6	5.22e-06	53.1	1951	0.102	0.050	A0A0B4KGI6_DROME Canoe, isoform G OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
16	P19524	2.17e-04	47.8	1574	0.034	0.021	MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO2 PE=1 SV=1
17	Q9Y4I1	2.24e-04	47.8	1855	0.078	0.040	MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens OX=9606 GN=MYO5A PE=1 SV=2
18	Q99104	3.00e-04	47.4	1853	0.078	0.040	MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2
19	A0A0B4KFK9	3.30e-04	47.4	1721	0.079	0.044	A0A0B4KFK9_DROME Canoe, isoform F OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
20	Q9VN82	4.91e-04	46.6	2051	0.079	0.037	Q9VN82_DROME Canoe, isoform E OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01843 DIL	4.3e-20	83.2	DIL domain
2	PF00788 RA	2.4e-07	42.6	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260526	0.945	Rho GTPase-activating protein 29
2	9606.ENSP00000250559	0.876	Ras-related protein Rap-1b
3	9606.ENSP00000256196	0.797	Ras-related protein R-Ras2
4	9606.ENSP00000246792	0.740	Ras-related protein R-Ras
5	9606.ENSP00000311502	0.715	Protein HEG homolog 1
6	9606.ENSP00000245304	0.689	Ras-related protein Rap-2a
7	9606.ENSP00000253047	0.686	Transmembrane protein 160
8	9606.ENSP00000246802	0.667	Ribosome biogenesis protein NOP53
9	9606.ENSP00000358723	0.662	Ras-related protein Rap-1A
10	9606.ENSP00000421922	0.640	Alpha-2-macroglobulin receptor-associated protein
11	9606.ENSP00000085068	0.632	Isochorismatase domain containing 2
12	9606.ENSP00000293405	0.609	Izumo sperm-egg fusion protein 2
13	9606.ENSP00000378712	0.590	Izumo sperm-egg fusion protein 4
14	9606.ENSP00000367817	0.582	Podocalyxin
15	9606.ENSP00000312021	0.577	Galactoside 2-alpha-L-fucosyltransferase 1
16	9606.ENSP00000469413	0.570	Serine/threonine-protein kinase PAK 4
17	9606.ENSP00000332454	0.555	Receptor-interacting serine/threonine-protein kinase 4
18	9606.ENSP00000393922	0.548	Iporin
19	9606.ENSP00000297063	0.547	Uncharacterized protein KIAA0895
20	9606.ENSP00000474230	0.539	Ras-like protein family member 10B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051020	0.987	GTPase binding
GO:0042802	0.963	identical protein binding
GO:0042803	0.950	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050794	0.911	regulation of cellular process
GO:0009987	0.905	cellular process
GO:0048518	0.728	positive regulation of biological process
GO:0048522	0.705	positive regulation of cellular process
GO:0065009	0.665	regulation of molecular function
GO:0051128	0.644	regulation of cellular component organization
GO:0019222	0.621	regulation of metabolic process
GO:0032502	0.574	developmental process
GO:0048856	0.553	anatomical structure development
GO:0050790	0.550	regulation of catalytic activity
GO:0032501	0.546	multicellular organismal process
GO:0048583	0.516	regulation of response to stimulus
GO:0050896	0.491	response to stimulus
GO:0031323	0.485	regulation of cellular metabolic process
GO:0048523	0.484	negative regulation of cellular process
GO:0060255	0.481	regulation of macromolecule metabolic process
GO:0009966	0.480	regulation of signal transduction
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0007154	0.428	cell communication
GO:0051716	0.427	cellular response to stimulus
GO:0023052	0.426	signaling
GO:0080090	0.426	regulation of primary metabolic process
GO:0044087	0.419	regulation of cellular component biogenesis
GO:0007165	0.415	signal transduction
GO:0051246	0.394	regulation of protein metabolic process
GO:0065008	0.359	regulation of biological quality
GO:0007275	0.339	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0030054	0.997	cell junction
GO:0005911	0.988	cell-cell junction
GO:0005622	0.931	intracellular anatomical structure
GO:0005829	0.907	cytosol
GO:0016020	0.888	membrane
GO:0043227	0.813	membrane-bounded organelle
GO:0043229	0.786	intracellular organelle
GO:0043231	0.760	intracellular membrane-bounded organelle
GO:0031982	0.305	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]