StarFunc result for job id Q5UCC4

User Input

>input (262 residues)
MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSF
EIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALD
GLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLEL
FNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMS
GAPDTGGQGGGGGGGGGGGSGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5UCC4	1.000	1.000	9.431E-53	262	1.000	1.000	Q5UCC4.pdb.gz	EMC10_HUMAN ER membrane protein complex subunit 10 OS=Homo sapiens OX=9606 GN=EMC10 PE=1 SV=1
2	AFDB:Q3TAS6	0.790	0.801	1.512E-44	258	0.844	0.857	Q3TAS6.pdb.gz	EMC10_MOUSE ER membrane protein complex subunit 10 OS=Mus musculus OX=10090 GN=Emc10 PE=2 SV=2
3	AFDB:Q8IPT0	0.521	0.589	1.089E-17	227	0.221	0.256	Q8IPT0.pdb.gz	Q8IPT0_DROME ER membrane protein complex subunit 10, isoform C OS=Drosophila melanogaster OX=7227 GN=EMC10 PE=1 SV=2
4	AFDB:O80798	0.429	0.389	1.043E-14	292	0.237	0.212	O80798.pdb.gz	O80798_ARATH AT1G65270 protein OS=Arabidopsis thaliana OX=3702 GN=At1g65270 PE=1 SV=1
5	AFDB:P40517	0.093	0.081	2.901E-2	327	0.057	0.046	P40517.pdb.gz	YRB2_YEAST Ran-specific GTPase-activating protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB2 PE=1 SV=1
6	AFDB:E9QHV7	0.204	0.054	3.290E-2	1342	0.126	0.025	E9QHV7.pdb.gz
7	AFDB:Q8IX03	0.117	0.045	3.974E-2	1113	0.137	0.032	Q8IX03.pdb.gz	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
8	AFDB:P16410	0.155	0.175	6.176E-2	223	0.069	0.081	P16410.pdb.gz	CTLA4_HUMAN Cytotoxic T-lymphocyte protein 4 OS=Homo sapiens OX=9606 GN=CTLA4 PE=1 SV=3
9	AFDB:H2KYE0	0.144	0.044	7.946E-2	1123	0.092	0.021	H2KYE0.pdb.gz	NRA4_CAEEL Nicotinic receptor-associated protein 4 OS=Caenorhabditis elegans OX=6239 GN=nra-4 PE=1 SV=1
10	AFDB:D2XMV0	0.124	0.064	1.022E-1	594	0.115	0.051	D2XMV0.pdb.gz
11	PDB:6kg7A	0.172	0.051	1.056E-1	1817	0.065	0.009	6kg7A.pdb.gz
12	PDB:3it8D	0.086	0.079	1.198E-1	299	0.034	0.030	3it8D.pdb.gz
13	PDB:7ungX	0.134	0.060	1.198E-1	701	0.076	0.029	7ungX.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:7wluA	0.200	0.062	1.276E-1	1498	0.095	0.017	7wluA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
15	PDB:7wltA	0.194	0.057	1.862E-1	1353	0.095	0.018	7wltA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
16	PDB:1dt9A	0.107	0.075	1.983E-1	398	0.099	0.065	1dt9A.pdb.gz
17	PDB:1eta1	0.172	0.307	2.112E-1	127	0.046	0.094	1eta1.pdb.gz	The x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic Val-30-->Met variant to 1.7-A resolution.
18	PDB:3m1iB	0.090	0.141	2.249E-1	131	0.031	0.061	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
19	PDB:2iglA	0.176	0.335	2.893E-1	116	0.042	0.095	2iglA.pdb.gz
20	PDB:7a1gc	0.100	0.135	2.893E-1	144	0.027	0.049	7a1gc.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5UCC4	0.0	527	262	1.000	1.000	EMC10_HUMAN ER membrane protein complex subunit 10 OS=Homo sapiens OX=9606 GN=EMC10 PE=1 SV=1
2	Q3TAS6	6.33e-149	418	258	0.805	0.818	EMC10_MOUSE ER membrane protein complex subunit 10 OS=Mus musculus OX=10090 GN=Emc10 PE=2 SV=2
3	Q8IPT0	2.20e-14	72.4	227	0.164	0.189	Q8IPT0_DROME ER membrane protein complex subunit 10, isoform C OS=Drosophila melanogaster OX=7227 GN=EMC10 PE=1 SV=2
4	O80798	5.67e-12	66.6	292	0.229	0.205	O80798_ARATH AT1G65270 protein OS=Arabidopsis thaliana OX=3702 GN=At1g65270 PE=1 SV=1
5	Q1K9B6	0.32	34.3	223	0.042	0.049	YFS2_SCHPO Uncharacterized protein C19D5.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC19D5.02c PE=3 SV=1
6	Q57WA5	0.70	33.5	548	0.164	0.078	Q57WA5_TRYB2 Flagellar radial spoke protein-like, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.890 PE=4 SV=1
7	Q57YB5	1.8	32.3	1165	0.107	0.024	Q57YB5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.13M20.300 PE=1 SV=1
8	D6XL11	2.2	32.0	338	0.076	0.059	D6XL11_TRYB2 Mitochondrial RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.830 PE=4 SV=1
9	Q86PT1	2.2	32.0	338	0.076	0.059	Q86PT1_9TRYP Mitochondrial RNA-binding protein RBP38 OS=Trypanosoma brucei OX=5691 GN=RBP38 PE=4 SV=1
10	Q5A799	4.9	30.4	191	0.069	0.094	Q5A799_CANAL Coi1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COI1 PE=4 SV=1
11	Q94517	5.9	30.8	521	0.076	0.038	HDAC1_DROME Histone deacetylase HDAC1 OS=Drosophila melanogaster OX=7227 GN=HDAC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334037

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220853	0.999	ER membrane protein complex subunit 2
2	9606.ENSP00000245046	0.999	ER membrane protein complex subunit 3
3	9606.ENSP00000253457	0.999	ER membrane protein complex subunit 8
4	9606.ENSP00000256545	0.999	ER membrane protein complex subunit 7
5	9606.ENSP00000267750	0.999	ER membrane protein complex subunit 4
6	9606.ENSP00000306220	0.999	Membrane magnesium transporter 1
7	9606.ENSP00000380322	0.999	ER membrane protein complex subunit 6
8	9606.ENSP00000403210	0.999	ER membrane protein complex subunit 9
9	9606.ENSP00000420608	0.999	ER membrane protein complex subunit 1
10	9606.ENSP00000293441	0.727	SH3 and multiple ankyrin repeat domains protein 1
11	9606.ENSP00000471272	0.710	Protein FAM71E1
12	9606.ENSP00000340914	0.687	Synaptotagmin-3
13	9606.ENSP00000469315	0.670	Kallikrein-15
14	9606.ENSP00000390011	0.662	Cytoplasmic tRNA 2-thiolation protein 1
15	9606.ENSP00000260228	0.623	Matrix metalloproteinase-20
16	9606.ENSP00000369075	0.609	Major centromere autoantigen B
17	9606.ENSP00000270593	0.587	Testicular acid phosphatase
18	9606.ENSP00000305480	0.572	Flap endonuclease 1
19	9606.ENSP00000276461	0.543	Erlin-2
20	9606.ENSP00000377060	0.520	Chromobox protein homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032977	1.000	membrane insertase activity
GO:0005488	0.453	binding
GO:0005515	0.443	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071840	0.955	cellular component organization or biogenesis
GO:0045048	0.951	protein insertion into ER membrane
GO:0050789	0.943	regulation of biological process
GO:0050794	0.930	regulation of cellular process
GO:0048522	0.823	positive regulation of cellular process
GO:0051239	0.767	regulation of multicellular organismal process
GO:0001938	0.763	positive regulation of endothelial cell proliferation
GO:0045766	0.762	positive regulation of angiogenesis
GO:0071816	0.316	tail-anchored membrane protein insertion into ER membrane
GO:0045050	0.316	protein insertion into ER membrane by stop-transfer membrane-anchor sequence

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005576	0.999	extracellular region
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0032991	0.991	protein-containing complex
GO:0005789	0.985	endoplasmic reticulum membrane
GO:0140534	0.920	endoplasmic reticulum protein-containing complex
GO:0098796	0.901	membrane protein complex
GO:0072546	0.891	EMC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]