StarFunc result for job id Q5UE93

User Input

>input (754 residues)
MESSDVELDLQRSVQAVLRELSTQAPALQSNQGMWRWSLHKKVERDPGKSPVLVRILLRE
LEKAESQDLRHVIIPLLHTVMYVLTKATGITEELYQRIYAFCTRLLTLPTPYCTVALDCA
IRLKTEMAVPGTLYQRMVIAEQNLTNELYPYQERVFLFVDPELVSASVCSALLLEIEAAQ
AQQTPETCMRHVVSHALQAALGEACHAGALHRKLQASPRRTLEHYFHAVVAALEQMASEA
SPSREGHVERLEEIYCSLLGPAAGRCGGDLVQERPPSIPLPSPYITFHLWTGEEQLWKEL
VLFLRPRSQLRLSADLEVLDLQGLRPDRELARVSVLSTDSGIERDLPTGADELPAPGSPE
MERAGLQRKGGIKKRAWPLDFLMPGSWDGPPGLHRRTGRPSGDGEMLPGVSRLHTARVLV
LGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPVLAPEKPAASRQPELGELATF
LGRVDPWYQSNVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYIRMGTQPIYFQIYT
VKIFFSDLSQDPTEDIFLIELKVKIQDSKFPKDGFSPRRRGVAEGPGAELSLCYQKALLS
HRPREVTVSLRATGLILKAIPASDTEVSGSSHCPLPAAPVTDHTCLNVNVTEVVKSSNLA
GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSK
APWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5UE93	1.000	1.000	0.000	754	1.000	1.000	Q5UE93.pdb.gz	PI3R6_HUMAN Phosphoinositide 3-kinase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PIK3R6 PE=1 SV=1
2	AFDB:Q3U6Q4	0.907	0.905	6.623E-103	756	0.830	0.828	Q3U6Q4.pdb.gz	PI3R6_MOUSE Phosphoinositide 3-kinase regulatory subunit 6 OS=Mus musculus OX=10090 GN=Pik3r6 PE=1 SV=1
3	AFDB:L7RT34	0.714	0.617	6.015E-41	880	0.261	0.224	L7RT34.pdb.gz	L7RT34_HUMAN Phosphoinositide-3-kinase, regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=4 SV=1
4	AFDB:D4A4I3	0.716	0.623	4.070E-40	872	0.260	0.225	D4A4I3.pdb.gz	D4A4I3_RAT Phosphoinositide-3-kinase, regulatory subunit 5 OS=Rattus norvegicus OX=10116 GN=Pik3r5 PE=1 SV=1
5	AFDB:O02696	0.705	0.611	8.492E-40	877	0.257	0.221	O02696.pdb.gz	PI3R5_PIG Phosphoinositide 3-kinase regulatory subunit 5 OS=Sus scrofa OX=9823 GN=PIK3R5 PE=1 SV=1
6	PDB:7mezB	0.585	0.787	5.960E-24	547	0.190	0.261	7mezB.pdb.gz
7	PDB:1u0rD	0.185	0.410	5.842E-6	301	0.049	0.123	1u0rD.pdb.gz
8	PDB:1u0tB	0.190	0.457	2.090E-5	276	0.054	0.149	1u0tB.pdb.gz
9	PDB:2i2aA	0.191	0.463	2.671E-5	264	0.041	0.117	2i2aA.pdb.gz	NAD kinases use substrate-assisted catalysis for specific recognition of NAD.
10	PDB:4l02A	0.177	0.335	5.572E-5	360	0.042	0.089	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
11	PDB:2qv7A	0.169	0.365	3.099E-4	303	0.049	0.122	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
12	PDB:2bonA	0.132	0.287	4.367E-4	287	0.053	0.139	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
13	AFDB:E9QGC4	0.059	0.045	6.079E-4	1112	0.129	0.087	E9QGC4.pdb.gz	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
14	PDB:2an1B	0.178	0.418	6.465E-4	281	0.040	0.107	2an1B.pdb.gz
15	PDB:3afoA	0.180	0.338	2.097E-3	360	0.036	0.075	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
16	AFDB:Q9UUD0	0.055	0.077	9.942E-3	501	0.092	0.138	Q9UUD0.pdb.gz	YNQA_SCHPO Uncharacterized protein C19C2.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19C2.10 PE=1 SV=1
17	AFDB:A0A024R5A7	0.118	0.140	2.650E-2	622	0.105	0.127	A0A024R5A7.pdb.gz
18	AFDB:Q8IX03	0.055	0.044	3.070E-2	1113	0.125	0.084	Q8IX03.pdb.gz	KIBRA_HUMAN Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1
19	AFDB:Q8L7A9	0.112	0.094	3.923E-2	938	0.113	0.091	Q8L7A9.pdb.gz	AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=At1g31730 PE=1 SV=1
20	PDB:1wv4A	0.045	0.136	7.891E-2	162	0.031	0.142	1wv4A.pdb.gz	Structure of Escherichia coli pyridoxine 5'-phosphate oxidase in a tetragonal crystal form: insights into the mechanistic pathway of the enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U6Q4	0.0	1255	756	0.832	0.829	PI3R6_MOUSE Phosphoinositide 3-kinase regulatory subunit 6 OS=Mus musculus OX=10090 GN=Pik3r6 PE=1 SV=1
2	Q5UE93	0.0	1545	754	1.000	1.000	PI3R6_HUMAN Phosphoinositide 3-kinase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PIK3R6 PE=1 SV=1
3	D4A4I3	8.86e-29	125	872	0.153	0.132	D4A4I3_RAT Phosphoinositide-3-kinase, regulatory subunit 5 OS=Rattus norvegicus OX=10116 GN=Pik3r5 PE=1 SV=1
4	Q5SW28	1.92e-27	121	871	0.150	0.130	PI3R5_MOUSE Phosphoinositide 3-kinase regulatory subunit 5 OS=Mus musculus OX=10090 GN=Pik3r5 PE=1 SV=1
5	J3KSW1	3.30e-27	120	879	0.155	0.133	J3KSW1_HUMAN Phosphoinositide-3-kinase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
6	L7RT34	2.04e-26	118	880	0.155	0.133	L7RT34_HUMAN Phosphoinositide-3-kinase, regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=4 SV=1
7	Q8WYR1	2.04e-26	118	880	0.155	0.133	PI3R5_HUMAN Phosphoinositide 3-kinase regulatory subunit 5 OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
8	O02696	2.74e-26	117	877	0.153	0.131	PI3R5_PIG Phosphoinositide 3-kinase regulatory subunit 5 OS=Sus scrofa OX=9823 GN=PIK3R5 PE=1 SV=1
9	J3KT66	0.36	33.9	93	0.025	0.204	J3KT66_HUMAN Phosphoinositide-3-kinase regulatory subunit 5 (Fragment) OS=Homo sapiens OX=9606 GN=PIK3R5 PE=1 SV=1
10	P0C093	1.7	33.5	198	0.019	0.071	SLMA_ECOLI Nucleoid occlusion factor SlmA OS=Escherichia coli (strain K12) OX=83333 GN=slmA PE=1 SV=1
11	P13029	1.9	34.3	726	0.048	0.050	KATG_ECOLI Catalase-peroxidase OS=Escherichia coli (strain K12) OX=83333 GN=katG PE=1 SV=2
12	O48724	3.2	33.5	807	0.034	0.032	WEB1_ARATH Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1 OS=Arabidopsis thaliana OX=3702 GN=WEB1 PE=1 SV=1
13	O54752	5.2	33.1	739	0.023	0.023	O54752_MOUSE Naglu OS=Mus musculus OX=10090 GN=Naglu PE=2 SV=1
14	O88325	5.3	32.7	739	0.023	0.023	O88325_MOUSE Alpha-N-acetylglucosaminidase OS=Mus musculus OX=10090 GN=Naglu PE=1 SV=1
15	Q38BS5	7.5	32.3	561	0.029	0.039	Q38BS5_TRYB2 Multifunctional fusion protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4280 PE=3 SV=1
16	A0A2R8Y852	9.7	32.3	1460	0.038	0.020	A0A2R8Y852_HUMAN Homeobox protein cut-like OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10486 PI3K_1B_p101	5.2e-52	188.4	Phosphoinositide 3-kinase gamma adapter protein p101 subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352121	0.993	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
2	9606.ENSP00000282096	0.978	cGMP-inhibited 3',5'-cyclic phosphodiesterase B
3	9606.ENSP00000289153	0.965	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
4	9606.ENSP00000334448	0.961	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
5	9606.ENSP00000481878	0.958	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
6	9606.ENSP00000263967	0.951	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
7	9606.ENSP00000428056	0.947	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000366563	0.935	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
9	9606.ENSP00000392812	0.926	Phosphoinositide 3-kinase regulatory subunit 5
10	9606.ENSP00000387784	0.925	Son of sevenless homolog 1
11	9606.ENSP00000262741	0.924	Phosphatidylinositol 3-kinase regulatory subunit gamma
12	9606.ENSP00000289902	0.920	High affinity immunoglobulin epsilon receptor subunit gamma
13	9606.ENSP00000451828	0.919	RAC-alpha serine/threonine-protein kinase
14	9606.ENSP00000364907	0.918	Tyrosine-protein kinase SYK
15	9606.ENSP00000482548	0.913	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
16	9606.ENSP00000222254	0.910	Phosphatidylinositol 3-kinase regulatory subunit beta
17	9606.ENSP00000302486	0.910	Dual specificity mitogen-activated protein kinase kinase 1
18	9606.ENSP00000428924	0.909	Tyrosine-protein kinase Lyn
19	9606.ENSP00000256078	0.908	GTPase KRas
20	9606.ENSP00000386884	0.908	C-X-C chemokine receptor type 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.994	catalytic activity
GO:0030234	0.986	enzyme regulator activity
GO:0035014	0.953	phosphatidylinositol 3-kinase regulator activity
GO:0016740	0.905	transferase activity
GO:0016301	0.899	kinase activity
GO:0016773	0.884	phosphotransferase activity, alcohol group as acceptor
GO:0035004	0.741	phosphatidylinositol 3-kinase activity
GO:0046935	0.645	1-phosphatidylinositol-3-kinase regulator activity
GO:0046934	0.481	phosphatidylinositol-4,5-bisphosphate 3-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.994	response to stimulus
GO:0009987	0.994	cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0007165	0.979	signal transduction
GO:0051239	0.969	regulation of multicellular organismal process
GO:0002682	0.967	regulation of immune system process
GO:0048583	0.966	regulation of response to stimulus
GO:0048522	0.945	positive regulation of cellular process
GO:0051240	0.932	positive regulation of multicellular organismal process
GO:0050793	0.919	regulation of developmental process
GO:0051094	0.889	positive regulation of developmental process
GO:2000026	0.864	regulation of multicellular organismal development
GO:0002684	0.804	positive regulation of immune system process
GO:0007186	0.798	G protein-coupled receptor signaling pathway
GO:0050776	0.780	regulation of immune response
GO:0065009	0.779	regulation of molecular function
GO:0019222	0.752	regulation of metabolic process
GO:0080134	0.729	regulation of response to stress
GO:0048584	0.691	positive regulation of response to stimulus
GO:0032101	0.662	regulation of response to external stimulus
GO:0050865	0.631	regulation of cell activation
GO:0031323	0.625	regulation of cellular metabolic process
GO:0023051	0.616	regulation of signaling
GO:0010646	0.616	regulation of cell communication
GO:0060255	0.610	regulation of macromolecule metabolic process
GO:0009966	0.608	regulation of signal transduction
GO:0050790	0.592	regulation of catalytic activity
GO:0002831	0.567	regulation of response to biotic stimulus
GO:0002697	0.540	regulation of immune effector process
GO:0002694	0.531	regulation of leukocyte activation
GO:0080090	0.525	regulation of primary metabolic process
GO:0042325	0.519	regulation of phosphorylation
GO:0009893	0.488	positive regulation of metabolic process
GO:0031325	0.470	positive regulation of cellular metabolic process
GO:1902531	0.458	regulation of intracellular signal transduction
GO:0051338	0.447	regulation of transferase activity
GO:0031347	0.440	regulation of defense response
GO:0023056	0.425	positive regulation of signaling
GO:0030155	0.413	regulation of cell adhesion
GO:0010647	0.384	positive regulation of cell communication
GO:0051171	0.376	regulation of nitrogen compound metabolic process
GO:0043549	0.375	regulation of kinase activity
GO:0031399	0.366	regulation of protein modification process
GO:0001932	0.358	regulation of protein phosphorylation
GO:0043085	0.350	positive regulation of catalytic activity
GO:0045088	0.349	regulation of innate immune response
GO:0022407	0.340	regulation of cell-cell adhesion
GO:0009967	0.337	positive regulation of signal transduction
GO:0051249	0.334	regulation of lymphocyte activation
GO:0002706	0.328	regulation of lymphocyte mediated immunity
GO:0010604	0.328	positive regulation of macromolecule metabolic process
GO:0031341	0.327	regulation of cell killing
GO:0002696	0.316	positive regulation of leukocyte activation
GO:0022603	0.304	regulation of anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005942	0.998	phosphatidylinositol 3-kinase complex
GO:0071944	0.945	cell periphery
GO:0005886	0.939	plasma membrane
GO:0043226	0.930	organelle
GO:0043229	0.862	intracellular organelle
GO:0043231	0.799	intracellular membrane-bounded organelle
GO:0097651	0.736	phosphatidylinositol 3-kinase complex, class I
GO:0005634	0.386	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.905	Transferases.
EC:2.7.-.-	0.899	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.884	Phosphotransferases with an alcohol group as acceptor.
RHEA:21292	0.481	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+)
EC:2.7.1.153	0.481	phosphatidylinositol-4,5-bisphosphate 3-kinase.

[back to server]