StarFunc result for job id Q5UIP0

User Input

>input (2472 residues)
MTARGQSPLAPLLETLEDPSASHGGQTDAYLTLTSRMTGEEGKEVITEIEKKLPRLYKVL
KTHISSQNSELSSAALQALGFCLYNPKITSELSEANALELLSKLNDTIKNSDKNVRTRAL
WVISKQTFPSEVVGKMVSSIIDSLEILFNKGETHSAVVDFEALNVIVRLIEQAPIQMGEE
AVRWAKLVIPLVVHSAQKVHLRGATALEMGMPLLLQKQQEIASITEQLMTTKLISELQKL
FMSKNETYVLKLWPLFVKLLGRTLHRSGSFINSLLQLEELGFRSGAPMIKKIAFIAWKSL
IDNFALNPDILCSAKRLKLLMQPLSSIHVRTETLALTKLEVWWYLLMRLGPHLPANFEQV
CVPLIQSTISIDSNASPQGNSCHVATSPGLNPMTPVHKGASSPYGAPGTPRMNLSSNLGG
MATIPSIQLLGLEMLLHFLLGPEALSFAKQNKLVLSLEPLEHPLISSPSFFSKHANTLIT
AVHDSFVAVGKDAPDVVVSAIWKELISLVKSVTESGNKKEKPGSEVLTLLLKSLESIVKS
EVFPVSKTLVLMEITIKGLPQKVLGSPAYQVANMDILNGTPALFLIQLIFNNFLECGVSD
ERFFLSLESLVGCVLSGPTSPLAFSDSVLNVINQNAKQLENKEHLWKMWSVIVTPLTELI
NQTNEVNQGDALEHNFSAIYGALTLPVNHIFSEQRFPVATMKTLLRTWSELYRAFARCAA
LVATAEENLCCEELSSKIMSSLEDEGFSNLLFVDRIIYIITVMVDCIDFSPYNIKYQPKV
KSPQRPSDWSKKKNEPLGKLTSLFKLIVKVIYSFHTLSFKEAHSDTLFTIGNSITGIISS
VLGHISLPSMIRKIFATLTRPLALFYENSKLDEVPKVYSCLNNKLEKLLGEIIACLQFSY
TGTYDSELLEQLSPLLCIIFLHKNKQIRKQSAQFWNATFAKVMMLVYPEELKPVLTQAKQ
KFLLLLPGLETVEMMEESSGPYSDGTENSQLNVKISGMERKSNGKRDSFLAQTKNKKENM
KPAAKLKLESSSLKVKGEILLEEEKSTDFVFIPPEGKDAKERILTDHQKEVLKTKRCDIP
AMYNNLDVSQDTLFTQYSQEEPMEIPTLTRKPKEDSKMMITEEQMDSDIVIPQDVTEDCG
MAEHLEKSSLSNNECGSLDKTSPEMSNSNNDERKKALISSRKTSTECASSTENSFVVSSS
SVSNTTVAGTPPYPTSRRQTFITLEKFDGSENRPFSPSPLNNISSTVTVKNNQETMIKTD
FLPKAKQREGTFSKSDSEKIVNGTKRSSRRAGKAEQTGNKRSKPLMRSEPEKNTEESVEG
IVVLENNPPGLLNQTECVSDNQVHLSESTMEHDNTKLKAATVENAVLLETNTVEEKNVEI
NLESKENTPPVVISADQMVNEDSQVQITPNQKTLRRSSRRRSEVVESTTESQDKENSHQK
KERRKEEEKPLQKSPLHIKDDVLPKQKLIAEQTLQENLIEKGSNLHEKTLGETSANAETE
QNKKKADPENIKSEGDGTQDIVDKSSEKLVRGRTRYQTRRASQGLLSSIENSESDSSEAK
EEGSRKKRSGKWKNKSNESVDIQDQEEKVVKQECIKAENQSHDYKATSEEDVSIKSPICE
KQDESNTVICQDSTVTSDLLQVPDDLPNVCEEKNETSKYAEYSFTSLPVPESNLRTRNAI
KRLHKRDSFDNCSLGESSKIGISDISSLSEKTFQTLECQHKRSRRVRRSKGCDCCGEKSQ
PQEKSLIGLKNTENNDVEISETKKADVQAPVSPSETSQANPYSEGQFLDEHHSVNFHLGL
KEDNDTINDSLIVSETKSKENTMQESLPSGIVNFREEICDMDSSEAMSLESQESPNENFK
TVGPCLGDSKNVSQESLETKEEKPEETPKMELSLENVTVEGNACKVTESNLEKAKTMELN
VGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLNAKEVATEEFNSDISLSDNTT
PVKLNAQTEISEQTAAGELDGGNDVSDLHSSEETNTKMKNNEEMMIGEAMAETGHDGETE
NEGITTKTSKPDEAETNMLTAEMDNFVCDTVEMSTEEGIIDANKTETNTEYSKSEEKLDN
NQMVMESDILQEDHHTSQKVEEPSQCLASGTAISELIIEDNNASPQKLRELDPSLVSAND
SPSGMQTRCVWSPLASPSTSILKRGLKRSQEDEISSPVNKVRRVSFADPIYQAGLADDID
RRCSIVRSHSSNSSPIGKSVKTSPTTQSKHNTTSAKGFLSPGSRSPKFKSSKKCLISEMA
KESIPCPTESVYPPLVNCVAPVDIILPQITSNMWARGLGQLIRAKNIKTIGDLSTLTASE
IKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLV
SDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSCMANSVIKNLQ
SRWRSPSHENSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E1C2U2	0.436	0.461	0.000	2326	0.510	0.542	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
2	AFDB:Q5UIP0	1.000	1.000	0.000	2472	1.000	1.000	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
3	AFDB:Q6PR54	0.436	0.446	0.000	2419	0.702	0.718	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
4	AFDB:P29539	0.168	0.209	3.423E-18	1916	0.094	0.121	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
5	AFDB:F4J8G7	0.106	0.118	9.795E-12	2138	0.083	0.096	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
6	AFDB:F4IAT2	0.068	0.081	5.296E-9	1823	0.086	0.116	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
7	AFDB:Q9VW47	0.088	0.087	2.224E-8	2531	0.081	0.079	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
8	AFDB:Q9VAS9	0.065	0.066	2.577E-8	2417	0.123	0.126	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
9	PDB:4a0cA	0.094	0.180	3.772E-8	1155	0.058	0.125	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
10	PDB:6xu2A	0.123	0.238	4.881E-8	1091	0.046	0.104	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
11	PDB:6ahd1	0.079	0.149	9.124E-8	1048	0.042	0.098	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
12	PDB:2xwuB	0.125	0.279	9.821E-8	910	0.048	0.130	2xwuB.pdb.gz
13	PDB:3w3uA	0.121	0.235	1.019E-7	1030	0.049	0.117	3w3uA.pdb.gz
14	AFDB:O95996	0.080	0.083	1.350E-7	2303	0.125	0.134	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
15	PDB:3w3zA	0.106	0.212	1.472E-7	1013	0.051	0.124	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	PDB:7wttK	0.106	0.215	2.050E-7	1022	0.047	0.113	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:7mqaSP	0.108	0.107	2.962E-7	2485	0.058	0.058	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7unkA	0.122	0.249	3.694E-7	1047	0.055	0.131	7unkA.pdb.gz
19	PDB:6gx9A	0.111	0.238	4.959E-7	912	0.047	0.127	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
20	AFDB:A0A0G2JZW4	0.076	0.078	2.863E-6	2308	0.121	0.130	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E1C2U2	0.0	1752	2326	0.405	0.430	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
2	Q5UIP0	0.0	5068	2472	1.000	1.000	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
3	Q6PR54	0.0	3194	2419	0.705	0.720	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
4	Q9XZ34	3.32e-11	71.6	1416	0.021	0.036	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
5	Q96UP3	4.83e-11	71.2	1400	0.026	0.046	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15845 NICE-1	1.9e+02	14.3	Cysteine-rich C-terminal 1 family
2	PF12231 Rif1_N	1.1e-73	260.0	Rap1-interacting factor 1 N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371475	0.991	TP53-binding protein 1
2	9606.ENSP00000341779	0.914	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
3	9606.ENSP00000278616	0.904	Serine-protein kinase ATM
4	9606.ENSP00000384048	0.901	PAX-interacting protein 1
5	9606.ENSP00000360623	0.894	Origin recognition complex subunit 1
6	9606.ENSP00000265056	0.876	DNA replication licensing factor MCM2
7	9606.ENSP00000264156	0.868	DNA replication licensing factor MCM6
8	9606.ENSP00000418960	0.849	Breast cancer type 1 susceptibility protein
9	9606.ENSP00000326031	0.835	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
10	9606.ENSP00000216122	0.831	DNA replication licensing factor MCM5
11	9606.ENSP00000351575	0.831	Transcription factor TFIIIB component B'' homolog
12	9606.ENSP00000387361	0.830	Strawberry notch homolog 1
13	9606.ENSP00000313171	0.821	ATPase family AAA domain-containing protein 5
14	9606.ENSP00000365588	0.814	Mediator of DNA damage checkpoint protein 1
15	9606.ENSP00000262105	0.791	DNA replication licensing factor MCM4
16	9606.ENSP00000301019	0.791	DNA replication factor Cdt1
17	9606.ENSP00000366434	0.773	BRCA1-A complex subunit RAP80
18	9606.ENSP00000229307	0.763	Homeobox protein NANOG
19	9606.ENSP00000229595	0.760	Histone chaperone ASF1A
20	9606.ENSP00000307288	0.736	DNA replication licensing factor MCM7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0044237	0.986	cellular metabolic process
GO:0050896	0.981	response to stimulus
GO:0006807	0.980	nitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0006259	0.972	DNA metabolic process
GO:0048523	0.962	negative regulation of cellular process
GO:0051276	0.958	chromosome organization
GO:0000018	0.958	regulation of DNA recombination
GO:0051716	0.953	cellular response to stimulus
GO:0051053	0.952	negative regulation of DNA metabolic process
GO:0033554	0.936	cellular response to stress
GO:0032200	0.932	telomere organization
GO:0006974	0.922	cellular response to DNA damage stimulus
GO:0000723	0.909	telomere maintenance
GO:0010569	0.906	regulation of double-strand break repair via homologous recombination
GO:0048518	0.899	positive regulation of biological process
GO:0048522	0.887	positive regulation of cellular process
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:0010604	0.879	positive regulation of macromolecule metabolic process
GO:0031325	0.879	positive regulation of cellular metabolic process
GO:0045935	0.873	positive regulation of nucleobase-containing compound metabolic process
GO:0045910	0.831	negative regulation of DNA recombination
GO:2001021	0.811	negative regulation of response to DNA damage stimulus
GO:0051054	0.752	positive regulation of DNA metabolic process
GO:0048584	0.747	positive regulation of response to stimulus
GO:0045739	0.735	positive regulation of DNA repair
GO:2000781	0.628	positive regulation of double-strand break repair
GO:0010468	0.316	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035861	1.000	site of double-strand break
GO:0005654	0.997	nucleoplasm
GO:0016020	0.994	membrane
GO:0012505	0.975	endomembrane system
GO:0098687	0.956	chromosomal region
GO:0000781	0.953	chromosome, telomeric region
GO:0032991	0.930	protein-containing complex
GO:0016604	0.930	nuclear body
GO:0005886	0.926	plasma membrane
GO:0015630	0.888	microtubule cytoskeleton
GO:0005737	0.767	cytoplasm
GO:0031090	0.765	organelle membrane
GO:0031967	0.753	organelle envelope
GO:0000793	0.750	condensed chromosome
GO:0005819	0.728	spindle
GO:0005635	0.706	nuclear envelope
GO:0031965	0.679	nuclear membrane
GO:0051233	0.616	spindle midzone
GO:0000785	0.525	chromatin
GO:0140445	0.380	chromosome, telomeric repeat region
GO:0005829	0.355	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]