StarFunc result for job id Q5VST6

User Input

>input (288 residues)
MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSS
REKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINC
NIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLA
ARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDF
SHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VST6	1.000	1.000	6.453E-66	288	1.000	1.000	Q5VST6.pdb.gz	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1
2	AFDB:Q5XIJ5	0.968	0.900	2.465E-55	310	0.778	0.723	Q5XIJ5.pdb.gz	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
3	AFDB:Q6PCB6	0.919	0.806	3.647E-53	329	0.788	0.690	Q6PCB6.pdb.gz	AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens OX=9606 GN=ABHD17C PE=1 SV=2
4	AFDB:Q9VBX8	0.961	0.968	2.321E-52	286	0.691	0.696	Q9VBX8.pdb.gz	Q9VBX8_DROME IP15857p OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=2
5	AFDB:Q21221	0.919	0.799	4.585E-46	332	0.594	0.515	Q21221.pdb.gz	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
6	AFDB:Q84JV3	0.864	0.846	1.580E-36	294	0.410	0.401	Q84JV3.pdb.gz	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
7	AFDB:Q9S7U7	0.858	0.688	3.523E-36	361	0.434	0.346	Q9S7U7.pdb.gz	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
8	AFDB:Q8VYT1	0.862	0.912	5.101E-36	272	0.424	0.449	Q8VYT1.pdb.gz	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
9	AFDB:Q8RXP6	0.749	0.705	5.688E-20	308	0.233	0.218	Q8RXP6.pdb.gz	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1
10	AFDB:Q7L211	0.706	0.607	8.235E-20	337	0.205	0.175	Q7L211.pdb.gz	ABHDD_HUMAN Protein ABHD13 OS=Homo sapiens OX=9606 GN=ABHD13 PE=2 SV=1
11	PDB:4kryE	0.594	0.528	4.924E-12	329	0.170	0.149	4kryE.pdb.gz
12	PDB:7prmA	0.617	0.603	1.691E-11	295	0.167	0.163	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
13	PDB:2ocgA	0.546	0.613	2.946E-11	254	0.128	0.146	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
14	PDB:6eicB	0.598	0.616	3.134E-11	279	0.149	0.154	6eicB.pdb.gz
15	PDB:7jn7A	0.586	0.219	1.012E-10	846	0.188	0.064	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
16	PDB:5hfnD	0.569	0.578	1.145E-10	283	0.163	0.166	5hfnD.pdb.gz
17	PDB:2gbfA	0.549	0.246	1.875E-10	730	0.167	0.066	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
18	PDB:6y0fC	0.527	0.239	2.552E-10	722	0.174	0.069	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
19	PDB:5xb6A	0.595	0.563	2.887E-10	306	0.153	0.144	5xb6A.pdb.gz
20	PDB:3dduA	0.543	0.250	3.474E-10	707	0.142	0.058	3dduA.pdb.gz	Pyrrolidinyl pyridone and pyrazinone analogues as potent inhibitors of prolyl oligopeptidase (POP)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VST6	0.0	603	288	1.000	1.000	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1
2	Q6AY17	0.0	602	288	0.997	0.997	AB17B_RAT Alpha/beta hydrolase domain-containing protein 17B OS=Rattus norvegicus OX=10116 GN=Abhd17b PE=1 SV=1
3	Q7M759	0.0	602	288	0.997	0.997	AB17B_MOUSE Alpha/beta hydrolase domain-containing protein 17B OS=Mus musculus OX=10090 GN=Abhd17b PE=1 SV=1
4	B5DFK7	5.97e-172	479	320	0.785	0.706	AB17C_RAT Alpha/beta hydrolase domain-containing protein 17C OS=Rattus norvegicus OX=10116 GN=Abhd17c PE=1 SV=1
5	Q8VCV1	5.97e-172	479	320	0.785	0.706	AB17C_MOUSE Alpha/beta hydrolase domain-containing protein 17C OS=Mus musculus OX=10090 GN=Abhd17c PE=1 SV=2
6	Q6PCB6	1.54e-170	476	329	0.785	0.687	AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens OX=9606 GN=ABHD17C PE=1 SV=2
7	Q96GS6	4.98e-162	454	310	0.788	0.732	AB17A_HUMAN Alpha/beta hydrolase domain-containing protein 17A OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
8	Q5XIJ5	2.00e-160	450	310	0.774	0.719	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
9	Q9VBX8	6.86e-144	407	286	0.691	0.696	Q9VBX8_DROME IP15857p OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=2
10	A0A4D6K2Q0	1.30e-143	409	349	0.691	0.570	A0A4D6K2Q0_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=1
11	Q21221	8.87e-122	353	332	0.583	0.506	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
12	Q8VYT1	1.24e-76	236	272	0.427	0.452	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
13	Q84JV3	3.74e-76	236	294	0.417	0.408	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
14	Q9S7U7	3.74e-76	238	361	0.438	0.349	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
15	K7EQ25	3.57e-50	167	225	0.358	0.458	K7EQ25_HUMAN Abhydrolase domain containing 17A, depalmitoylase OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
16	P9WLC7	7.06e-23	97.4	281	0.219	0.224	Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2307c PE=1 SV=1
17	Q4GYA0	2.33e-18	87.0	670	0.240	0.103	Q4GYA0_TRYB2 Serine peptidase, putative serine peptidase, Clan SC, Family S9D OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4780 PE=4 SV=1
18	P54069	1.59e-17	82.8	299	0.236	0.227	BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bem46 PE=2 SV=3
19	Q80UX8	8.66e-15	75.5	337	0.222	0.190	ABHDD_MOUSE Protein ABHD13 OS=Mus musculus OX=10090 GN=Abhd13 PE=2 SV=1
20	Q8RXP6	1.49e-13	71.6	308	0.188	0.175	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	0.0011	30.2	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	32	15.7	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	1.1e+02	14.1	Phospholipase/Carboxylesterase
4	PF12695 Abhydrolase_5	15	16.8	Alpha/beta hydrolase family
5	PF12697 Abhydrolase_6	0.0026	29.9	Alpha/beta hydrolase family
6	PF16929 Asp2	1.9e+02	12.5	Accessory Sec system GspB-transporter
7	PF20434 BD-FAE	19	16.2	BD-FAE
8	PF01738 DLH	3.6	18.6	Dienelactone hydrolase family
9	PF05677 DUF818	17	15.9	Chlamydia CHLPS protein (DUF818)
10	PF03959 FSH1	13	17.0	Serine hydrolase (FSH1)
11	PF12146 Hydrolase_4	8.4e-09	46.6	Serine aminopeptidase, S33
12	PF00326 Peptidase_S9	0.00048	31.2	Prolyl oligopeptidase family
13	PF05728 UPF0227	7.6	17.9	Uncharacterised protein family (UPF0227)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10036.XP_005063283.1

Rank	PPI partner	STRING score	Description
1	10036.XP_005076727.1	0.689	GTPase NRas
2	10036.XP_005064275.1	0.609	Ras proteins bind GDP/GTP and possess intrinsic GTPase activity
3	10036.XP_005085985.1	0.608	Acyl-protein thioesterase 1
4	10036.XP_005072200.1	0.603	Non-specific lipid-transfer protein isoform X1
5	10036.XP_005072988.1	0.603	GTPase KRas isoform X1
6	10036.XP_005079675.1	0.580	Acyl-protein thioesterase 2
7	10036.XP_005082509.1	0.503	Lysophospholipase-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008474	1.000	palmitoyl-(protein) hydrolase activity
GO:0005488	0.694	binding
GO:0005515	0.396	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042157	0.991	lipoprotein metabolic process
GO:0035601	0.987	protein deacylation
GO:0030163	0.982	protein catabolic process
GO:0050794	0.978	regulation of cellular process
GO:0099175	0.745	regulation of postsynapse organization
GO:0060341	0.475	regulation of cellular localization
GO:0048518	0.455	positive regulation of biological process
GO:0048522	0.424	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005886	0.997	plasma membrane
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005737	0.972	cytoplasm
GO:0031090	0.878	organelle membrane
GO:0098588	0.639	bounding membrane of organelle
GO:0031410	0.434	cytoplasmic vesicle
GO:0005768	0.404	endosome
GO:0045202	0.396	synapse
GO:0030659	0.390	cytoplasmic vesicle membrane
GO:0098794	0.387	postsynapse
GO:0010008	0.380	endosome membrane
GO:0099572	0.368	postsynaptic specialization
GO:0014069	0.358	postsynaptic density
GO:0055037	0.325	recycling endosome
GO:0098978	0.318	glutamatergic synapse
GO:0098590	0.308	plasma membrane region
GO:0097060	0.301	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19233	1.000	H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]
EC:3.1.2.22	1.000	palmitoyl-protein hydrolase.

[back to server]