StarFunc result for job id Q5VST9

User Input

>input (1400 residues)
MDQPQFSGAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQ
DGDLYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIR
VREGSEATFRCRVGGSPRPAVSWSKDGRRLGEPDGPRVRVEELGEASALRIRAARPRDGG
TYEVRAENPLGAASAAAALVVDSDAADTASRPGTSTAALLAHLQRRREAMRAEGAPASPP
STGTRTCTVTEGKHARLSCYVTGEPKPETVWKKDGQLVTEGRRHVVYEDAQENFVLKILF
CKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRLQDLEVREKESATFLCEVPQPS
TEAAWFKEETRLWASAKYGIEEEGTERRLTVRNVSADDDAVYICETPEGSRTVAELAVQG
NLLRKLPRKTAVRVGDTAMFCVELAVPVGPVHWLRNQEEVVAGGRVAISAEGTRHTLTIS
QCCLEDVGQVAFMAGDCQTSTQFCVSAPRKPPLQPPVDPVVKARMESSVILSWSPPPHGE
RPVTIDGYLVEKKKLGTYTWIRCHEAEWVATPELTVADVAEEGNFQFRVSALNSFGQSPY
LEFPGTVHLAPKLAVRTPLKAVQAVEGGEVTFSVDLTVASAGEWFLDGQALKASSVYEIH
CDRTRHTLTIREVPASLHGAQLKFVANGIESSIRMEVRAAPGLTANKPPAAAAREVLARL
HEEAQLLAELSDQAAAVTWLKDGRTLSPGPKYEVQASAGRRVLLVRDVARDDAGLYECVS
RGGRIAYQLSVQGLARFLHKDMAGSCVDAVAGGPAQFECETSEAHVHVHWYKDGMELGHS
GERFLQEDVGTRHRLVAATVTRQDEGTYSCRVGEDSVDFRLRVSEPKVVFAKEQLARRKL
QAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVCMEATGCTRRLVVQQAGQADAGEY
SCEAGGQRLSFHLDVKEPKVVFAKDQVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGK
KLSSSLKVHVEAKGCRRRLVVQQAGKTDAGDYSCEARGQRVSFRLHITEPKMMFAKEQSV
HNEVQAEAGASAMLSCEVAQAQTEVTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKAD
AGEYSCEAGGQRVSFHLHITEPKGVFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWY
KDGKKLSSSSKVRMEVKGCTRRLVVQQVGKADAGEYSCEAGGQRVSFQLHITEPKAVFAK
EQLVHNEVRTEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQA
GQADAGEYTCEAGGQRLSFHLDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQTE
VTWYKDGKKLSSSSKVRMEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140LGX4	0.159	0.199	0.000	1010	0.332	0.460	A0A140LGX4.pdb.gz
2	AFDB:D3ZZ80	0.261	0.211	0.000	1805	0.310	0.240	D3ZZ80.pdb.gz	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
3	AFDB:O75147	0.215	0.165	0.000	1896	0.316	0.233	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
4	AFDB:Q15746	0.110	0.092	5.402E-60	1914	0.201	0.147	Q15746.pdb.gz	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
5	AFDB:Q90688	0.101	0.110	1.042E-58	1272	0.151	0.166	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
6	AFDB:P56741	0.090	0.098	2.711E-58	1274	0.163	0.179	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
7	AFDB:Q6PDN3	0.113	0.092	3.563E-58	1941	0.194	0.140	Q6PDN3.pdb.gz	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
8	AFDB:A0A1L1QZU5	0.119	0.126	7.726E-58	1287	0.144	0.156	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
9	AFDB:P52179	0.117	0.099	3.028E-57	1685	0.164	0.136	P52179.pdb.gz	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
10	AFDB:Q14896	0.090	0.098	3.383E-56	1274	0.166	0.183	Q14896.pdb.gz	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
11	PDB:1e07A	0.069	0.132	4.595E-22	642	0.079	0.173	1e07A.pdb.gz
12	PDB:5oj2B	0.094	0.148	4.595E-22	692	0.083	0.168	5oj2B.pdb.gz
13	PDB:7sqcO0	0.107	0.124	1.755E-20	1140	0.069	0.084	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:6dldD	0.060	0.289	1.688E-15	269	0.043	0.223	6dldD.pdb.gz
15	PDB:7q5zA	0.084	0.086	1.043E-14	1344	0.057	0.060	7q5zA.pdb.gz
16	PDB:5a42A	0.080	0.075	1.435E-14	1597	0.093	0.081	5a42A.pdb.gz
17	PDB:7q1yA	0.092	0.092	2.262E-14	1374	0.070	0.071	7q1yA.pdb.gz
18	PDB:2rcjC	0.075	0.142	2.973E-14	523	0.054	0.145	2rcjC.pdb.gz
19	PDB:6dlfA	0.062	0.319	6.002E-13	236	0.045	0.267	6dlfA.pdb.gz
20	PDB:7vonA	0.102	0.102	3.882E-12	1399	0.069	0.069	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUP3	0.0	2246	7329	0.800	0.153	A0A0G2JUP3_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Obscn PE=1 SV=2
2	A2AAJ9	0.0	2226	8886	0.799	0.126	OBSCN_MOUSE Obscurin OS=Mus musculus OX=10090 GN=Obscn PE=1 SV=3
3	A6NGQ3	0.0	1108	8923	0.424	0.066	A6NGQ3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=5
4	D3ZZ80	0.0	661	1805	0.319	0.247	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
5	O75147	0.0	676	1896	0.323	0.238	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
6	Q5VST9	0.0	2849	7968	1.000	0.176	OBSCN_HUMAN Obscurin OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=3
7	A2ASS6	3.37e-97	349	35213	0.223	0.009	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
8	Q8WZ42	1.39e-95	344	34350	0.221	0.009	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
9	A0A8I5ZUN3	5.27e-95	342	35375	0.256	0.010	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
10	A0A8I5ZU83	8.74e-95	342	26931	0.256	0.013	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
11	Q7TN00	1.60e-79	293	3410	0.253	0.104	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
12	A0A8I6A794	8.74e-76	281	5475	0.225	0.058	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
13	D3YXG0	9.83e-73	272	5634	0.257	0.064	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
14	A2AJ76	1.32e-70	265	5100	0.263	0.072	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
15	E7F3V2	6.30e-69	259	4212	0.261	0.087	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
16	Q8NDA2	3.93e-62	238	5059	0.261	0.072	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
17	O01761	4.86e-62	237	8081	0.249	0.043	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
18	Q96RW7	6.90e-61	234	5635	0.241	0.060	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
19	G5EDG4	9.51e-50	197	3962	0.246	0.087	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
20	G5EG33	4.82e-44	179	5198	0.230	0.062	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	4e-14	64.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	8.1e-16	69.2	CD80-like C2-set immunoglobulin domain
3	PF11020 DUF2610	78	14.6	Domain of unknown function (DUF2610)
4	PF00041 fn3	0.00012	33.7	Fibronectin type III domain
5	PF07679 I-set	2.8e-186	615.5	Immunoglobulin I-set domain
6	PF00047 ig	2.2e-95	324.3	Immunoglobulin domain
7	PF13895 Ig_2	1.2e-81	280.4	Immunoglobulin domain
8	PF13927 Ig_3	2.1e-135	452.9	Immunoglobulin domain
9	PF16680 Ig_4	2e-20	84.5	T-cell surface glycoprotein CD3 delta chain
10	PF16681 Ig_5	8.8e-14	63.0	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
11	PF18452 Ig_6	1.2e-15	68.9	Immunoglobulin domain
12	PF19081 Ig_7	2.1e-05	36.0	Ig-like domain CHU_C associated
13	PF17736 Ig_C17orf99	0.34	22.3	C17orf99 Ig domain
14	PF16706 Izumo-Ig	2.7e-11	54.6	Izumo-like Immunoglobulin domain
15	PF07676 PD40	3.8	18.9	WD40-like Beta Propeller Repeat
16	PF11465 Receptor_2B4	0.24	23.0	Natural killer cell receptor 2B4
17	PF07686 V-set	2.6e-37	138.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000139

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000014501	0.963	Titin
2	9601.ENSPPYP00000020798	0.949	Ankyrin 1, erythrocytic
3	9601.ENSPPYP00000016765	0.833	Ankyrin 2, neuronal
4	9601.ENSPPYP00000015522	0.741	Transforming protein RhoA
5	9601.ENSPPYP00000009530	0.729	Titin-cap
6	9601.ENSPPYP00000004265	0.704	Ankyrin repeat domain 42
7	9601.ENSPPYP00000021391	0.672	Rho guanine nucleotide exchange factor (GEF) 39
8	9601.ENSPPYP00000000440	0.667	Asp (abnormal spindle) homolog, microcephaly associated (Drosophila)
9	9601.ENSPPYP00000008953	0.661	Myosin, heavy chain 10, non-muscle
10	9601.ENSPPYP00000002809	0.660	Ankyrin 3, node of Ranvier (ankyrin G)
11	9601.ENSPPYP00000009171	0.659	Rhomboid-like protein
12	9601.ENSPPYP00000004264	0.654	PCF11 cleavage and polyadenylation factor subunit
13	9601.ENSPPYP00000005656	0.654	Myosin, light chain 2, regulatory, cardiac, slow
14	9601.ENSPPYP00000020436	0.654	non-SMC condensin II complex, subunit G2
15	9601.ENSPPYP00000011362	0.647	Striatin, calmodulin binding protein 4
16	9601.ENSPPYP00000009865	0.646	Tubulin folding cofactor D
17	9601.ENSPPYP00000016684	0.646	RAP1, GTP-GDP dissociation stimulator 1
18	9601.ENSPPYP00000014341	0.643	Uncharacterized protein
19	9601.ENSPPYP00000006712	0.630	Spectrin, beta, erythrocytic
20	9601.ENSPPYP00000013141	0.616	Parvalbumin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.977	cellular component organization
GO:0032502	0.877	developmental process
GO:0048856	0.862	anatomical structure development
GO:0032989	0.834	cellular component morphogenesis
GO:0031032	0.825	actomyosin structure organization
GO:0055002	0.805	striated muscle cell development
GO:0050789	0.767	regulation of biological process
GO:0097435	0.734	supramolecular fiber organization
GO:0140694	0.733	non-membrane-bounded organelle assembly
GO:0030239	0.700	myofibril assembly
GO:0023051	0.523	regulation of signaling
GO:0010646	0.523	regulation of cell communication
GO:0048583	0.489	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005622	0.994	intracellular anatomical structure
GO:0043226	0.986	organelle
GO:0016020	0.954	membrane
GO:0005737	0.954	cytoplasm
GO:0043229	0.950	intracellular organelle
GO:0071944	0.943	cell periphery
GO:0031974	0.933	membrane-enclosed lumen
GO:0005886	0.928	plasma membrane
GO:0043231	0.855	intracellular membrane-bounded organelle
GO:0005634	0.820	nucleus
GO:0005654	0.812	nucleoplasm
GO:0016604	0.794	nuclear body
GO:0005829	0.776	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]