StarFunc result for job id Q5VSY0

User Input

>input (366 residues)
MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRR
KKKEQQQSEANELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQ
LTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVS
LKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCT
AHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEG
EMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNS
ESDQCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5VSY0	1.000	1.000	3.138E-52	366	1.000	1.000	Q5VSY0.pdb.gz	GKAP1_HUMAN G kinase-anchoring protein 1 OS=Homo sapiens OX=9606 GN=GKAP1 PE=1 SV=2
2	AFDB:Q9JMB0	0.353	0.353	3.432E-42	366	0.880	0.880	Q9JMB0.pdb.gz	GKAP1_MOUSE G kinase-anchoring protein 1 OS=Mus musculus OX=10090 GN=Gkap1 PE=1 SV=1
3	AFDB:Q1ZXL0	0.155	0.073	2.842E-4	808	0.172	0.078	Q1ZXL0.pdb.gz	Y5795_DICDI PH domain-containing protein DDB_G0275795 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275795 PE=4 SV=1
4	AFDB:E7F789	0.247	0.101	1.804E-2	1011	0.175	0.063	E7F789.pdb.gz
5	AFDB:Q86A08	0.177	0.102	2.977E-2	799	0.172	0.079	Q86A08.pdb.gz	Q86A08_DICDI Centrosomal protein 91 kDa OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275495 PE=4 SV=1
6	AFDB:A2ASQ4	0.171	0.065	3.436E-2	1035	0.194	0.069	A2ASQ4.pdb.gz
7	AFDB:Q9BPU3	0.158	0.082	3.690E-2	792	0.142	0.066	Q9BPU3.pdb.gz	KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum OX=44689 GN=kif2 PE=2 SV=1
8	AFDB:O59725	0.259	0.188	3.964E-2	550	0.156	0.104	O59725.pdb.gz	MIC60_SCHPO MICOS complex subunit mic60 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mic60 PE=3 SV=1
9	AFDB:Q9VRY7	0.173	0.106	5.670E-2	659	0.175	0.097	Q9VRY7.pdb.gz	Q9VRY7_DROME GH13213p OS=Drosophila melanogaster OX=7227 GN=Rsph3 PE=1 SV=1
10	AFDB:C0L098	0.129	0.065	6.090E-2	823	0.131	0.058	C0L098.pdb.gz
11	PDB:7rroP	0.144	0.142	1.409	373	0.126	0.123	7rroP.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:7dcoL	0.149	0.129	2.498	435	0.120	0.101	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
13	PDB:7vf2C	0.159	0.279	3.838	184	0.087	0.174	7vf2C.pdb.gz
14	PDB:7d4iRQ	0.098	0.104	4.123	339	0.074	0.080	7d4iRQ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
15	PDB:7d5tRQ	0.098	0.104	4.758	339	0.079	0.086	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
16	PDB:6iczL	0.172	0.142	5.897	454	0.167	0.134	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:6id0L	0.172	0.138	5.897	475	0.153	0.118	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:6u427R	0.239	0.404	5.897	195	0.085	0.159	6u427R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
19	PDB:6wotA	0.064	0.013	5.897	4197	0.087	0.008	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
20	PDB:2rvqD	0.073	0.175	6.334	129	0.046	0.132	2rvqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5VSY0	0.0	746	366	1.000	1.000	GKAP1_HUMAN G kinase-anchoring protein 1 OS=Homo sapiens OX=9606 GN=GKAP1 PE=1 SV=2
2	Q9JMB0	0.0	624	366	0.880	0.880	GKAP1_MOUSE G kinase-anchoring protein 1 OS=Mus musculus OX=10090 GN=Gkap1 PE=1 SV=1
3	A0A1B0GWM3	0.12	37.0	3333	0.085	0.009	A0A1B0GWM3_RAT Laminin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Lama3 PE=4 SV=2
4	Q99M73	1.4	33.5	603	0.074	0.045	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
5	Q5U7D2	2.1	33.1	917	0.052	0.021	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
6	Q9ZSI7	2.3	32.7	489	0.060	0.045	WRK47_ARATH Probable WRKY transcription factor 47 OS=Arabidopsis thaliana OX=3702 GN=WRKY47 PE=1 SV=2
7	A0A0G2K6F4	2.7	32.7	845	0.052	0.022	A0A0G2K6F4_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1
8	Q9WVL6	2.9	32.3	918	0.052	0.021	EXTL3_MOUSE Exostosin-like 3 OS=Mus musculus OX=10090 GN=Extl3 PE=1 SV=2
9	O43909	3.0	32.3	919	0.052	0.021	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
10	Q9JMA8	3.0	32.3	919	0.052	0.021	Q9JMA8_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1
11	Q7TME2	5.8	31.6	1165	0.057	0.018	SPAG5_MOUSE Sperm-associated antigen 5 OS=Mus musculus OX=10090 GN=Spag5 PE=1 SV=1
12	Q13099	6.9	31.2	824	0.123	0.055	IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 PE=1 SV=3
13	Q9NSB2	8.0	31.2	600	0.077	0.047	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11594 Med28	7.8	18.4	Mediator complex subunit 28
2	PF16808 PKcGMP_CC	0.28	22.2	Coiled-coil N-terminus of cGMP-dependent protein kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363092	0.869	cGMP-dependent protein kinase 1
2	9606.ENSP00000334382	0.700	Homer protein homolog 1
3	9606.ENSP00000365522	0.601	Queuosine salvage protein
4	9606.ENSP00000318258	0.565	Cysteine/serine-rich nuclear protein 3
5	9606.ENSP00000262407	0.540	Integrin alpha-IIb
6	9606.ENSP00000381984	0.539	Regulation of nuclear pre-mRNA domain-containing protein 1A
7	9606.ENSP00000297814	0.520	Kinesin-like protein KIF27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.997	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0023052	0.992	signaling
GO:0007154	0.992	cell communication
GO:0051716	0.991	cellular response to stimulus
GO:0048583	0.990	regulation of response to stimulus
GO:0023051	0.987	regulation of signaling
GO:0010646	0.986	regulation of cell communication
GO:0007165	0.984	signal transduction
GO:0009966	0.975	regulation of signal transduction
GO:0048584	0.953	positive regulation of response to stimulus
GO:0007186	0.950	G protein-coupled receptor signaling pathway
GO:0048522	0.940	positive regulation of cellular process
GO:0009967	0.932	positive regulation of signal transduction
GO:0046626	0.905	regulation of insulin receptor signaling pathway
GO:1900076	0.899	regulation of cellular response to insulin stimulus
GO:0007187	0.848	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:1900078	0.830	positive regulation of cellular response to insulin stimulus
GO:0046628	0.308	positive regulation of insulin receptor signaling pathway
GO:0008152	0.302	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.996	Golgi apparatus
GO:0005634	0.795	nucleus
GO:0031974	0.662	membrane-enclosed lumen
GO:0070013	0.600	intracellular organelle lumen
GO:0031981	0.594	nuclear lumen
GO:0016020	0.578	membrane
GO:0005654	0.547	nucleoplasm
GO:0005829	0.311	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]