StarFunc result for job id Q5VT06

User Input

>input (1400 residues)
MRSSKSKEVPLPNPRNSQSKDTVQADITTSWDALSQTKAALRHIENKLEVAPTSTAVCDS
VMDTKKSSTSATRKISRKDGRYLDDSWVNAPISKSTKSRKEKSRSPLRATTLESNVKKNN
RVEFREPLVSYREIHGAPSNFSSSHLESKHVYCVDVNEEKTESGNWMIGSREERNIRSCD
FESSQSSVINDTVVRFLNDRPAIDALQNSECLIRMGASMRTEEEMPNRTKGSENNLKLSV
NNMAHDTDPKALRLTDSSPSSTSTSNSQRLDILKRRQHDVKLEKLKERIRKQWEHSEETN
GRGQKLGHIDHPVMVVNVDNSVTAKVRKVATAPPAPAYKGFNPSETKIRTPDGKVWQEAE
FQNMSRELYRDLALHFADDISIKEKPAEKSKEKKVVKPVRKVQKVAQLSSTECRTGSSHL
ISTSSWRDGQKLVKKILGPAPRMEPKEQRTASSDRGGRERTAKSGGHIGRAESDPRLDVL
HRHLQRNSERSRSKSRSENNIKKLASSLPDNKQEENTALNKDFLPIEIRGILDDLQLDST
AHTAKQDTVELQNQKSSAPVHAPRSHSPVKRKPDKITANEDPPVISKRRHYDTDEVRQYI
VRQQEERKRKQNEEKKAQKEATEQKNKRLQELYRKQKEAFTKVKNVPPSEPSATRRLQET
YSKLLLEKTLLEEPSHQHVTQETQAKPGYQPSGESDKENKVQERPPSASSSSDMSLSEPP
QPLARKDLMESTWMQPERLSPQVHHSQPQPFAGTAGSLLSHLLSLEHVGILHKDFESILP
TRKNHNMASRPLTFTPQPYVTSPAAYTDALLKPSASQYKSKLDRIEALKATAASLSSRIE
SEAKKLAGASINYGSAWNTEYDVQQAPQEDGPWTKAVTPPVKDDNEDVFSARIQKMLGSC
VSHATFDDDLPGVGNLSEFKKLPEMIRPQSAISSFRVRSPGPKPEGLLAQLCKRQTDSSS
SDMQACSQDKAKISLGSSIDSVSEGPLLSEGSLSEEEGDQDGQPLLKVAEILKEKEFCPG
ERNSYEPIKEFQKEAEKFLPLFGHIGGTQSKGPWEELAKGSPHSVINIFTKSYQLYGKGF
EDKLDRGTSTSRPLNATATPLSGVSYEDDFVSSPGTGTSTEKKSTLEPHSTLSPQEDHSN
RKSAYDPSSVDVTSQHSSGAQSAASSRSSTSSKGKKGKKEKTEWLDSFTGNVQNSLLDEE
KAERGSHQGKKSGTSSKLSVKDFEQTLDTDSTLEDLSGHSVSVSSDKGRSQKTPTSPLSP
SSQKSLQFDVAGTSSERSKSSVMPPTITGFKPNAPLTDLNPAASRTTTENMAPIPGSKRF
SPAGLHHRMAAELSYLNAIEESVRQLSDVERVRGISLAQQESVSLAQIIKAQQQRHERDL
ALLKLKAEQEALESQRQLEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U0U1	0.044	0.047	1.060E-6	1267	0.120	0.133	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
2	AFDB:M9PF57	0.040	0.041	1.585E-6	1385	0.137	0.139	M9PF57.pdb.gz	M9PF57_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=CG8154 PE=1 SV=1
3	AFDB:Q6P5H2	0.036	0.028	9.532E-5	1864	0.136	0.102	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
4	AFDB:M9PGW8	0.046	0.052	1.995E-4	1177	0.124	0.148	M9PGW8.pdb.gz	M9PGW8_DROME Bifocal, isoform D OS=Drosophila melanogaster OX=7227 GN=bif PE=1 SV=1
5	AFDB:O75362	0.036	0.045	5.463E-4	1048	0.098	0.131	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
6	AFDB:Q7KHG2	0.037	0.036	8.174E-4	1486	0.126	0.118	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
7	AFDB:M9PHA0	0.043	0.046	1.496E-3	1305	0.125	0.134	M9PHA0.pdb.gz	M9PHA0_DROME Bifocal, isoform F OS=Drosophila melanogaster OX=7227 GN=bif PE=1 SV=1
8	AFDB:P48681	0.034	0.031	1.957E-3	1621	0.140	0.121	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
9	AFDB:Q24079	0.038	0.042	2.238E-3	1221	0.127	0.146	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
10	AFDB:Q5T8A7	0.047	0.051	2.928E-3	1209	0.134	0.156	Q5T8A7.pdb.gz	PPR26_HUMAN Protein phosphatase 1 regulatory subunit 26 OS=Homo sapiens OX=9606 GN=PPP1R26 PE=1 SV=1
11	PDB:7eu4C	0.018	0.142	3.433	94	0.011	0.170	7eu4C.pdb.gz	Atg12-Interacting Motif Is Crucial for E2-E3 Interaction in Plant Atg8 System.
12	PDB:7ajtCK	0.024	0.103	5.874	207	0.015	0.101	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:6elzb	0.019	0.043	6.282	421	0.007	0.024	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
14	PDB:7ajuCK	0.032	0.121	8.218	222	0.016	0.104	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7nacm	0.027	0.047	8.789	666	0.014	0.029	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
16	PDB:6yxxAf	0.023	0.130	9.399	139	0.006	0.065	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
17	PDB:7lbmd	0.039	0.153	9.399	275	0.018	0.091	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q309	0.0	2070	3095	0.803	0.363	CE350_MOUSE Centrosome-associated protein 350 OS=Mus musculus OX=10090 GN=Cep350 PE=1 SV=1
2	Q5VT06	0.0	2880	3117	1.000	0.449	CE350_HUMAN Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1
3	Q8IVT4	0.002	45.4	953	0.034	0.050	Q8IVT4_HUMAN Hypothetical MGC50722 OS=Homo sapiens OX=9606 GN=MGC50722 PE=1 SV=1
4	A4LBC3	3.0	34.7	1590	0.016	0.014	A4LBC3_CAEEL Histone-lysine N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=met-1 PE=1 SV=1
5	A4LBC2	3.2	34.7	1604	0.016	0.014	A4LBC2_CAEEL Histone-lysine N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=met-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356579

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355812	0.981	FGFR1 oncogene partner
2	9606.ENSP00000392025	0.863	Ubiquitin carboxyl-terminal hydrolase CYLD
3	9606.ENSP00000264951	0.837	5'-3' exoribonuclease 1
4	9606.ENSP00000351575	0.817	Transcription factor TFIIIB component B'' homolog
5	9606.ENSP00000387209	0.788	Centrosomal protein of 19 kDa
6	9606.ENSP00000362392	0.768	Cilia- and flagella-associated protein 157
7	9606.ENSP00000221138	0.754	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
8	9606.ENSP00000238789	0.747	ATPase family, AAA domain containing 2B
9	9606.ENSP00000370021	0.738	Centlein
10	9606.ENSP00000345436	0.733	Caskin-1
11	9606.ENSP00000362774	0.727	Roquin-2
12	9606.ENSP00000371472	0.722	Ninein
13	9606.ENSP00000275034	0.715	PH-interacting protein
14	9606.ENSP00000402515	0.690	Serine/threonine-protein kinase SMG1
15	9606.ENSP00000233121	0.680	Microtubule-associated protein RP/EB family member 3
16	9606.ENSP00000458075	0.675	BOLA2-SMG1P6 readthrough
17	9606.ENSP00000324292	0.670	Fas-binding factor 1
18	9606.ENSP00000261716	0.668	Serine/threonine-protein kinase TAO1
19	9606.ENSP00000478783	0.657	E3 ubiquitin-protein ligase listerin
20	9606.ENSP00000351250	0.650	E3 ubiquitin-protein ligase TRIM33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0070925	0.990	organelle assembly
GO:0044782	0.988	cilium organization
GO:0030031	0.988	cell projection assembly
GO:0060271	0.918	cilium assembly
GO:0051179	0.889	localization
GO:1905508	0.882	protein localization to microtubule organizing center
GO:1905515	0.859	non-motile cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0016020	0.998	membrane
GO:0005814	0.997	centriole
GO:0043227	0.315	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]